KEGG   Plasmodium falciparum 3D7: PF11_0208Help
Entry
PF11_0208         CDS       T00095                                 

Definition
phosphoglycerate mutase, putative
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pfa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfa00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pfa00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
11:join(761694..761727,761883..761964,762181..762817)
Genome map
AA seq 250 aa AA seqDB search
MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVL
KRAICTAWNVLKTADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYD
IPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVM
VAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKM
DEVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactacttatactttagttcttttaagacatggtgaaagtacatggaacaaggaaaac
aagttcacaggatggaccgatgttcctttaagtgaaaagggagaagaagaagcaatagct
gctggaaaataccttaaggaaaagaatttcaaattcgacgttgtttatacatcagttttg
aagagagcaatttgcacagcctggaatgtattaaaaacagctgaccttttacatgttcca
gttgttaaaacttggagattaaatgaaaggcactatggttcccttcaaggtttaaacaaa
tcagaaacagccaagaagtatggagaggaacaagtaaaaatatggagaagatcatatgat
atccctccaccaaaattagataaggaagataacagatggccaggacacaatgttgtatat
aaaaatgtaccaaaggatgcattaccatttactgaatgtttaaaagatactgttgaacga
gtcttaccattctggtttgatcacatcgcacctgatattttagcaaataaaaaagttatg
gtagctgctcatggaaatagtttaagaggtttagtcaaacatttagataacttaagtgaa
gctgatgtattagaacttaacattccaacaggtgtacctttagtttatgaattagatgaa
aacttaaagccaataaaacactattatttattagatagtgaagaattaaaaaagaaaatg
gatgaagtagccaaccaaggaaaagcaaaataa

DBGET integrated database retrieval system