KEGG   Plasmodium falciparum 3D7: PF11_0208Help
Entry
PF11_0208         CDS       T00095                                 

Definition
phosphoglycerate mutase, putative
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF11_0208
   01230 Biosynthesis of amino acids
    PF11_0208
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF11_0208
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF11_0208
Enzymes [BR:pfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PF11_0208
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PF11_0208
  Exosomal proteins of melanoma cells
   PF11_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
11:join(761694..761727,761883..761964,762181..762817)
Genome map
AA seq 250 aa AA seqDB search
MTTYTLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVL
KRAICTAWNVLKTADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYD
IPPPKLDKEDNRWPGHNVVYKNVPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVM
VAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIKHYYLLDSEELKKKM
DEVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactacttatactttagttcttttaagacatggtgaaagtacatggaacaaggaaaac
aagttcacaggatggaccgatgttcctttaagtgaaaagggagaagaagaagcaatagct
gctggaaaataccttaaggaaaagaatttcaaattcgacgttgtttatacatcagttttg
aagagagcaatttgcacagcctggaatgtattaaaaacagctgaccttttacatgttcca
gttgttaaaacttggagattaaatgaaaggcactatggttcccttcaaggtttaaacaaa
tcagaaacagccaagaagtatggagaggaacaagtaaaaatatggagaagatcatatgat
atccctccaccaaaattagataaggaagataacagatggccaggacacaatgttgtatat
aaaaatgtaccaaaggatgcattaccatttactgaatgtttaaaagatactgttgaacga
gtcttaccattctggtttgatcacatcgcacctgatattttagcaaataaaaaagttatg
gtagctgctcatggaaatagtttaagaggtttagtcaaacatttagataacttaagtgaa
gctgatgtattagaacttaacattccaacaggtgtacctttagtttatgaattagatgaa
aacttaaagccaataaaacactattatttattagatagtgaagaattaaaaaagaaaatg
gatgaagtagccaaccaaggaaaagcaaaataa

DBGET integrated database retrieval system