KEGG   Plasmodium falciparum 3D7: PF11_0352Help
Entry
PF11_0352         CDS       T00095                                 

Gene name
PDI-11
Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PF11_0352 (PDI-11)
Enzymes [BR:pfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PF11_0352 (PDI-11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
11:complement(1323041..1324312)
Genome map
AA seq 423 aa AA seqDB search
MKVYNFSFICISLIFVFIKRSLGLYTNVAEIETVDNPKRLEELLNLKKVYLVQFYATWCR
VSRGFSNDFINIAKTLKDDVKFIAIKNESILNEYKITEYPTMHLIFGNEHNNKKEVEKFD
GKYKIKDVVSFIYEGIKNYRLKELNIDTSKKSSYKKKSKGKNDGKVIILNDSNFDQNVIQ
YDDNVWFVFFYAPWCGHSKPIHPMFDELAKKVAHLKNAKIAKIDATVEQRTAQTYQINHY
PSFRLFPSGNKKPHTAIDYNDSRTVDDLYHFFLKYYVEKKELIQLTSQQVFDEFCEKDVC
LLALLPNKEDTEPSYFKSYVHILSNVIKDVNHLPVTLLWTQAGDQLDIVQKLNLTFGFPT
VIALSLSKNVFSILKGNYSEQSIKNFITQMMMGKSSVDNLVPFKVKNVPKFSFNASNDIN
TEL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtataatttttcattcatatgtataagtttaattttcgttttcattaaacgt
agcttgggattatatacaaatgtagcagagatcgaaacagttgataaccctaaacggtta
gaagaattattaaatttaaaaaaagtgtatcttgttcagttttatgccacatggtgtagg
gtttcacgaggtttttctaacgacttcatcaatatagcaaaaacattaaaagatgatgtt
aaatttatagctataaaaaatgaaagtatattaaatgaatacaagattactgaatatcca
acaatgcatttaatttttggaaatgaacataataataaaaaagaagtagaaaaatttgat
ggaaaatataaaatcaaagatgtagtttcttttatatatgaaggtattaaaaattatcgt
ttaaaagaattgaatatagatacatccaaaaaaagttcatacaaaaaaaaatctaaaggt
aaaaatgacggaaaagtaatcattttaaatgatagtaattttgatcaaaatgttatacaa
tatgatgataatgtatggtttgtctttttctatgctccatggtgtggtcatagtaaacct
atacatccaatgtttgatgagctagccaaaaaagtagctcatttgaaaaatgctaaaata
gctaaaattgatgctacagtagaacaaagaacagcacaaacgtatcaaataaatcattat
ccatcttttagattatttccatcgggaaataaaaaacctcatactgcaattgattataat
gattcaagaactgttgatgatttatatcatttctttctaaaatattatgttgaaaaaaaa
gaattaattcaattaacatcacaacaagtttttgatgaattctgtgaaaaggatgtatgt
cttttagctctcttaccaaataaagaagatacagaaccttcatattttaaatcgtacgtt
catatattaagtaatgttattaaagacgtaaaccatttaccagttacattattatggaca
caagcaggtgatcaattggatattgttcaaaaattaaatttaacatttggtttcccaaca
gtaattgcattaagtctttcaaaaaatgttttttctatacttaaaggtaattattctgaa
caatccataaaaaattttattacacaaatgatgatgggcaaatcatccgtagataattta
gtaccatttaaagtaaaaaatgttccaaagttttcttttaacgcttctaatgatataaat
accgaattgtaa

DBGET integrated database retrieval system