KEGG   Plasmodium falciparum 3D7: PF13_0121Help
Entry
PF13_0121         CDS       T00095                                 

Definition
dihydrolipamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pfa00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pfa00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:join(855133..855162,855305..855410,855535..856664)
Genome map
AA seq 421 aa AA seqDB search
MTKNLVFRLNKSLLHHVKSFNRTFLNHKYNSNANIEGSLKRYFSIETIKVPRLGDSITEG
TINEWKKKVGDYVKADETITIIDTDKVSVDINSKVSGGLSKIFADVGDVVLVDAPLCEID
TSVEPPEDICKTKEEVGESKNNENNYTFNQLNRDIKDEAHIKDEVSKNEKDIFVKDPICF
GNDYESINERTERRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKAMLLRSELNDIF
QKKYSCKLGFVSLFMYASTLALKKMPNVNAYIENDEIVYKNYIDISVAVATPNGLTVPVI
RNCQNKNLPQLELALSDLATKARSNKLSIDDFSGGTFTISNGGVFGSMLSTPIINMPQSA
ILGMHTIKNRPVVVNNEIVIRPIMYLALTYDHRLLDGREAVQFLCAIRDYIENPNLMLID
C
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaatcttgtatttcgattaaataaatccttattacatcatgtcaaaagtttt
aatagaacatttttaaaccataagtataattcaaatgcaaatattgaaggatcacttaag
agatatttttccatagaaaccattaaagtacctagacttggtgattcaatcacagaaggt
acaataaatgaatggaaaaaaaaagtgggagattatgttaaggcggatgaaacgataaca
attatcgatacagataaagttagtgttgatataaattctaaagtaagtggagggttatcc
aaaatttttgcggatgtaggagatgttgttttggtagatgcacctttatgtgaaattgat
acatctgtagaaccacctgaagatatttgtaaaactaaagaggaagtaggagaaagtaaa
aataatgaaaataattatacatttaatcaattaaatagagatattaaagatgaagcacat
ataaaagatgaagttagtaaaaatgaaaaagatatttttgtaaaagatcctatatgtttt
ggaaatgattatgaatcaataaatgaaagaacagaaagaagagtccgtatgttacctata
agaaaaagaattgcagaacgattaaaggaatcacaaaatacatgtgctttattaacaaca
tttaatgaatgtgatatgtcaaaggcaatgttattaagaagtgaattaaatgatatattt
caaaaaaaatattcatgtaaattaggatttgtatcattatttatgtatgcatcaacattg
gctttaaaaaaaatgccaaatgtaaatgcatatatagaaaatgatgaaattgtatataaa
aattatatagatatatctgtagcagtagctacaccaaatggcttaaccgttccagttata
agaaattgtcaaaataaaaatttaccacaattagaattagctttatctgatttagctaca
aaagcacgatcaaataaattatcgattgatgattttagtggtggtacatttacaatatct
aatggaggtgtttttggtagtatgttaagtactcctattattaatatgccacagtcagct
attctaggaatgcatacaataaaaaatagaccagtagttgtcaataatgaaattgttatt
agaccaattatgtaccttgcccttacatatgatcatagattattagacggaagagaagcc
gtacaatttttatgtgcaataagagattatatagaaaaccctaatctaatgttaattgat
tgttaa

DBGET integrated database retrieval system