KEGG   Plasmodium falciparum 3D7: PF13_0121Help
Entry
PF13_0121         CDS       T00095                                 

Definition
dihydrolipamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF13_0121
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PF13_0121
  Amino acid metabolism
   00310 Lysine degradation
    PF13_0121
Enzymes [BR:pfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PF13_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:join(855133..855162,855305..855410,855535..856664)
Genome map
AA seq 421 aa AA seqDB search
MTKNLVFRLNKSLLHHVKSFNRTFLNHKYNSNANIEGSLKRYFSIETIKVPRLGDSITEG
TINEWKKKVGDYVKADETITIIDTDKVSVDINSKVSGGLSKIFADVGDVVLVDAPLCEID
TSVEPPEDICKTKEEVGESKNNENNYTFNQLNRDIKDEAHIKDEVSKNEKDIFVKDPICF
GNDYESINERTERRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKAMLLRSELNDIF
QKKYSCKLGFVSLFMYASTLALKKMPNVNAYIENDEIVYKNYIDISVAVATPNGLTVPVI
RNCQNKNLPQLELALSDLATKARSNKLSIDDFSGGTFTISNGGVFGSMLSTPIINMPQSA
ILGMHTIKNRPVVVNNEIVIRPIMYLALTYDHRLLDGREAVQFLCAIRDYIENPNLMLID
C
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaatcttgtatttcgattaaataaatccttattacatcatgtcaaaagtttt
aatagaacatttttaaaccataagtataattcaaatgcaaatattgaaggatcacttaag
agatatttttccatagaaaccattaaagtacctagacttggtgattcaatcacagaaggt
acaataaatgaatggaaaaaaaaagtgggagattatgttaaggcggatgaaacgataaca
attatcgatacagataaagttagtgttgatataaattctaaagtaagtggagggttatcc
aaaatttttgcggatgtaggagatgttgttttggtagatgcacctttatgtgaaattgat
acatctgtagaaccacctgaagatatttgtaaaactaaagaggaagtaggagaaagtaaa
aataatgaaaataattatacatttaatcaattaaatagagatattaaagatgaagcacat
ataaaagatgaagttagtaaaaatgaaaaagatatttttgtaaaagatcctatatgtttt
ggaaatgattatgaatcaataaatgaaagaacagaaagaagagtccgtatgttacctata
agaaaaagaattgcagaacgattaaaggaatcacaaaatacatgtgctttattaacaaca
tttaatgaatgtgatatgtcaaaggcaatgttattaagaagtgaattaaatgatatattt
caaaaaaaatattcatgtaaattaggatttgtatcattatttatgtatgcatcaacattg
gctttaaaaaaaatgccaaatgtaaatgcatatatagaaaatgatgaaattgtatataaa
aattatatagatatatctgtagcagtagctacaccaaatggcttaaccgttccagttata
agaaattgtcaaaataaaaatttaccacaattagaattagctttatctgatttagctaca
aaagcacgatcaaataaattatcgattgatgattttagtggtggtacatttacaatatct
aatggaggtgtttttggtagtatgttaagtactcctattattaatatgccacagtcagct
attctaggaatgcatacaataaaaaatagaccagtagttgtcaataatgaaattgttatt
agaccaattatgtaccttgcccttacatatgatcatagattattagacggaagagaagcc
gtacaatttttatgtgcaataagagattatatagaaaaccctaatctaatgttaattgat
tgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system