KEGG   Plasmodium falciparum 3D7: PF13_0269Help
Entry
PF13_0269         CDS       T00095                                 

Gene name
GK
Definition
glycerol kinase, putative (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pfa00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
13:2051547..2053052
Genome map
AA seq 501 aa AA seqDB search
MNVILSIDQSTQSTKVFFYDEELNIVHSNNLNHEQKCLKPGWYEHDPIEIMTNLYNLMNE
GIKVLKDKYTSVIIKCIGITNQRETVIIWDRITGKPLYNAIVWLDTRVEELVTEFSAKYN
NNDIQKKTGTYFNTYFSAFKILWLIQNNPEIKQKIDDGTAVIGNINTWLIFNLTKGNCYT
DVTNASRTLLMDINTLQWDEKMCKIFNITNMSVLPEIKSNCSNFGLVKSEHVPDYLNIPI
TGCIGDQQSACIGQAIFDEGEAKCTYGTGVFLLINTGEKVVYSTCGLITTICYKFNDNDK
PKYALEGSIGTAGSGVSWLLKNKLIDDPSEASDIMEKCENTTGVIFVPAFSGLYAPRWRS
DARASIYGMTFNTERSHIVRALLEGIAFQLNEIVDSLTSDMGIEMLHVLRCDGGMTKNKP
FMQFNSDIINTKIEVSKYKEVTSLGAAVLAGLEVKIWDSLDSVKSLLRRSDAVFHSKMDD
KKRKKKTSEWNKAVERTLIQL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcatattaagtatagaccaaagtacacaatcaaccaaagtgtttttctatgat
gaagaattaaatattgttcattcgaataatttaaatcatgaacaaaaatgtttgaaacct
ggttggtatgaacatgatccaatagagattatgaccaacttatataatttaatgaatgaa
ggaataaaagtgttaaaagataaatatacatctgttataataaaatgtataggtattact
aaccaaagagaaactgtaattatatgggatagaataacaggaaaacctttatacaatgct
atagtttggctagatacacgtgtagaagaacttgttacggaattttctgcgaaatataat
aataatgatattcagaaaaaaacaggaacttactttaatacatattttagtgcttttaaa
atattgtggttaattcaaaacaatccagaaatcaaacaaaaaattgatgatggtactgca
gttataggaaatattaatacatggcttatttttaatttaactaaagggaattgttataca
gatgttaccaatgcttcaagaactttattaatggatattaatacattacaatgggatgaa
aagatgtgtaaaatatttaatattactaatatgtctgttttacctgaaataaaaagtaat
tgttctaattttggtttagttaagtcagaacatgttccggactatttaaatattcctatt
actggatgtattggagatcaacaaagtgcatgcattggtcaagctatcttcgacgaaggt
gaagcgaaatgtacatatggtacaggtgtattccttctaattaatacaggagaaaaagtt
gtatattccacatgcggtttaattactactatatgttataaatttaatgataatgataaa
cctaaatatgctcttgaaggttcgataggtactgccggatctggagtttcatggcttctt
aaaaacaaactaattgatgatccaagtgaagctagcgatattatggaaaaatgtgaaaat
acaactggagtcatttttgtaccagctttcagtggattatatgcacccagatggagatct
gatgcacgtgcatccatatatggaatgacttttaatacggaaagaagccatattgtaaga
gcactattagaaggtatagcttttcagttaaatgaaattgtggactccttaacatcggat
atgggtattgaaatgttacatgtcttacgatgtgatggaggcatgacaaaaaataaacct
tttatgcaatttaactcagatattattaatacaaaaattgaagtttcaaaatataaagaa
gtaacttctcttggtgctgcagttctagctggattagaagttaaaatatgggacagtcta
gattctgttaaaagtttattaaggagaagtgacgctgtttttcattctaaaatggatgat
aaaaaaagaaaaaaaaaaacttccgaatggaataaagctgtcgaaaggacattaatacag
ttataa

DBGET integrated database retrieval system