KEGG   Plasmodium falciparum 3D7: PF13_0272Help
Entry
PF13_0272         CDS       T00095                                 

Definition
thioredoxin-related protein, putative (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PF13_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:complement(join(2089696..2090186,2090533..2090668))
Genome map
AA seq 208 aa AA seqDB search
MAIFKKSIIIFLFFTFFNYCFSQDVIELNDSNFESLTQLSTGNTTGSWFIKFYAPWCSHC
KAMSKTWAQLATELKGKINVAKIDVTLNSKTRKRFKIEGFPTLLYFKNGKMYDYKNHDRS
LEAFKNFVLETYKNAKASEPPKPLNYMDILKDFLNETFQNIDRIYKYAFPSLAVLVSVSF
LTGSIFSLILLKCCCMKSGASKVAKKKD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctatatttaagaagagtataataatatttcttttctttacatttttcaattattgt
ttttctcaagatgtaattgaattaaacgattcaaattttgagagtttaacacaattgtca
actggaaatactactggatcttggtttatcaaattttatgccccctggtgctcacactgt
aaagcaatgagcaaaacatgggcacaactagccactgaattaaaaggaaaaataaatgta
gctaaaattgatgtgaccttaaattctaaaacaagaaaaagatttaaaatagaaggtttc
ccaacacttttatattttaaaaatggaaagatgtatgattataaaaatcacgataggtcc
ttagaagcttttaaaaatttcgtcttagaaacatacaaaaatgccaaagcatctgaacca
cctaaaccacttaactatatggatattcttaaagattttttgaatgaaacttttcaaaat
atagatagaatttataaatacgctttcccatccttagctgttcttgtatccgtatcattc
ttaacaggttccatcttttctttaattttattgaaatgttgttgtatgaaaagtggagca
tcgaaagttgctaagaaaaaggattaa

DBGET integrated database retrieval system