KEGG   Plasmodium falciparum 3D7: PF13_0353Help
Entry
PF13_0353         CDS       T00095                                 

Definition
NADH-cytochrome b5 reductase, putative (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PF13_0353
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PF13_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
13:join(2688410..2689226,2689345..2689616)
Genome map
AA seq 362 aa AA seqDB search
MKRSFRSMLRSIFMRILYFLTSNISSIIIFCVSISFLGYFGKELHNNNKLFNLYSKKHEY
EELDTKEKSQEKPFLNGKNQSFKLYKIIKLTPTVKIFIFSYPDEYEYLGLGICKHIKFNA
SNIEGKIKGKWNNNDDKEKNLKQISRSYTPVYIDKKKKHVHFIIRVYYPDDEYIDGGKMS
IQLNKLNNNDEIDINGPFGLLEYKGNNELLHLSKSVKIKKHIVMIAGGTGMTPFFRLINH
LLLTKEKELPSDPVYITFIYANRNENEILLKSIFDDYENRFENFKRVYSVDKCLNTNQMG
NFENIGFINEELLRKYVLKYEKLNIEVKNKDTLILLCGPPPMTSSIKSILKDQIHMENII
VF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatcattcagatccatgcttagatccatctttatgagaatcctttatttttta
acatcaaatattagtagcataataattttttgtgtgtcgataagtttcttgggttatttt
ggaaaggagttacataataacaataaattatttaatttgtattcaaagaaacatgaatat
gaagaattagacacaaaagaaaaaagtcaagaaaagccttttttgaatggaaagaatcag
agttttaaattatataagataataaaattgacaccaacggttaagatatttatatttagt
tatcctgatgaatatgagtatttaggattaggtatttgtaaacatataaaattcaatgca
tcaaacattgaagggaaaataaaaggaaaatggaataataatgatgataaggaaaaaaat
ttgaaacagataagtcgaagttataccccagtatatattgacaaaaagaaaaaacatgtt
cattttattattcgtgtttattatccagatgatgaatatatagatggtgggaaaatgagt
atacaactaaataaattaaataataatgatgagatagatataaatggaccttttggatta
ctagagtataaaggaaacaatgaactcttgcatctttcaaaatctgttaaaattaaaaaa
catattgttatgattgctggtggtacaggaatgactcctttctttcgtttgataaatcat
ttattattaacaaaagaaaaggaacttccgagtgatcctgtttatatcacctttatatat
gctaacaggaacgagaatgaaatcttgttaaaatcgatttttgacgattatgaaaacagg
ttcgaaaatttcaagagggtatacagtgtagacaaatgtttgaatactaaccaaatgggc
aattttgaaaacatcggatttataaatgaagaattattaagaaaatatgttttgaaatat
gaaaagttaaatattgaagtaaaaaataaagataccttaattttattatgcggacctcca
ccaatgacaagttcaattaaatcaatattgaaggatcagatccacatggaaaatattata
gtattctaa

DBGET integrated database retrieval system