KEGG   Plasmodium falciparum 3D7: PF14_0020Help
Entry
PF14_0020         CDS       T00095                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PF14_0020
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PF14_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
14:71368..72690
Genome map
AA seq 440 aa AA seqDB search
MESKICDPIGLDKNKFRKVEEENEENSKIVENGQMTYNDDLEMFTTIQLNQEIDIRKNPF
PLHMINQKNDIPLCAQEFSKLTDPLYIKKICLEKVHDWSRCNEDDVCVNQILSGLTNQLF
EVSIKEDTAIEYRITRRHVLFRIYGKDVDALYNPLSEFEVYKTMSKYRIAPLLLNTFDGG
RIEEWLYGDPLSIDDLKNKSILVGIANVLGKFHTLSRKRHLPEHWDKTPCVFKMMDRWRL
AVSNYKNLDKVTLDINKYIQESHKFLKFIKIYTQIENIANDIVFCHNDLQENNIMNTNKC
LRLIDFEYSGYNFLSADIANFFIETTIDYSYNAYPFFIINKKNYISYESRILFVTTYLSK
YLDDSTAASDQDIIDQFLEAIEVQALGLHLIWAFWSIIRGYQTKSYNEFDFFLYAKERLK
MYDEQKQYLMSKNIIKDYDD
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaaatctgtgaccccattgggctcgataaaaataagtttcgtaaagtagaa
gaggaaaatgaggagaatagtaaaatagtagaaaatgggcaaatgacatataatgacgat
ttagaaatgttcacaacaatacaacttaatcaagaaatagatatacgtaagaaccctttt
ccattacatatgataaatcaaaagaatgatatacctttatgtgctcaagaattttcaaaa
ttaacagatcctttatatattaaaaaaatatgtcttgaaaaagtacatgattggtctagg
tgtaatgaagatgatgtatgtgtaaatcaaattttaagtggattaactaatcaacttttt
gaagttagtataaaagaagacacagcaattgaatatagaataacgagaagacatgtttta
tttagaatatatggaaaagatgtagatgcattatataatcctttaagtgaatttgaagta
tataaaacaatgagtaaatatagaatagcacctttattattaaatacatttgatggtggg
cgtatcgaggaatggttatatggagatcctctaagtattgatgatttaaaaaataaatct
atattagttggaatagccaatgtattaggaaaatttcatacacttagtcgaaaacgtcat
ttacctgaacactgggataaaactccttgtgtatttaaaatgatggataggtggagatta
gctgtatcgaattataaaaatcttgataaagtaaccttagatattaataaatatatacaa
gaatctcataaattcttaaaatttattaaaatatatacacaaatagaaaatatagcaaat
gatatcgttttttgtcataatgatttacaagaaaataatataatgaatacaaataaatgt
ttaagattaatcgattttgaatattcaggatataatttcctatcggcagatatagcaaac
ttctttatagaaacaacaatcgattattcatataacgcatatccattttttattattaat
aaaaaaaattacatctcatatgaatcaagaatactttttgtaacgacttatctatccaaa
tatctagatgattcaacagctgcttcggatcaagatatcatagaccaattcctagaagcc
atagaagtacaagctttaggtttacatctaatatgggcattctggtctatcataagagga
taccaaacaaaaagttataatgaatttgatttcttcttatatgcaaaggaaagacttaaa
atgtatgatgaacaaaaacaatatttaatgtccaaaaatattatcaaggattatgacgat
taa

DBGET integrated database retrieval system