KEGG   Plasmodium falciparum 3D7: PF14_0020Help
Entry
PF14_0020         CDS       T00095                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pfa00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
14:71368..72690
Genome map
AA seq 440 aa AA seqDB search
MESKICDPIGLDKNKFRKVEEENEENSKIVENGQMTYNDDLEMFTTIQLNQEIDIRKNPF
PLHMINQKNDIPLCAQEFSKLTDPLYIKKICLEKVHDWSRCNEDDVCVNQILSGLTNQLF
EVSIKEDTAIEYRITRRHVLFRIYGKDVDALYNPLSEFEVYKTMSKYRIAPLLLNTFDGG
RIEEWLYGDPLSIDDLKNKSILVGIANVLGKFHTLSRKRHLPEHWDKTPCVFKMMDRWRL
AVSNYKNLDKVTLDINKYIQESHKFLKFIKIYTQIENIANDIVFCHNDLQENNIMNTNKC
LRLIDFEYSGYNFLSADIANFFIETTIDYSYNAYPFFIINKKNYISYESRILFVTTYLSK
YLDDSTAASDQDIIDQFLEAIEVQALGLHLIWAFWSIIRGYQTKSYNEFDFFLYAKERLK
MYDEQKQYLMSKNIIKDYDD
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaaatctgtgaccccattgggctcgataaaaataagtttcgtaaagtagaa
gaggaaaatgaggagaatagtaaaatagtagaaaatgggcaaatgacatataatgacgat
ttagaaatgttcacaacaatacaacttaatcaagaaatagatatacgtaagaaccctttt
ccattacatatgataaatcaaaagaatgatatacctttatgtgctcaagaattttcaaaa
ttaacagatcctttatatattaaaaaaatatgtcttgaaaaagtacatgattggtctagg
tgtaatgaagatgatgtatgtgtaaatcaaattttaagtggattaactaatcaacttttt
gaagttagtataaaagaagacacagcaattgaatatagaataacgagaagacatgtttta
tttagaatatatggaaaagatgtagatgcattatataatcctttaagtgaatttgaagta
tataaaacaatgagtaaatatagaatagcacctttattattaaatacatttgatggtggg
cgtatcgaggaatggttatatggagatcctctaagtattgatgatttaaaaaataaatct
atattagttggaatagccaatgtattaggaaaatttcatacacttagtcgaaaacgtcat
ttacctgaacactgggataaaactccttgtgtatttaaaatgatggataggtggagatta
gctgtatcgaattataaaaatcttgataaagtaaccttagatattaataaatatatacaa
gaatctcataaattcttaaaatttattaaaatatatacacaaatagaaaatatagcaaat
gatatcgttttttgtcataatgatttacaagaaaataatataatgaatacaaataaatgt
ttaagattaatcgattttgaatattcaggatataatttcctatcggcagatatagcaaac
ttctttatagaaacaacaatcgattattcatataacgcatatccattttttattattaat
aaaaaaaattacatctcatatgaatcaagaatactttttgtaacgacttatctatccaaa
tatctagatgattcaacagctgcttcggatcaagatatcatagaccaattcctagaagcc
atagaagtacaagctttaggtttacatctaatatgggcattctggtctatcataagagga
taccaaacaaaaagttataatgaatttgatttcttcttatatgcaaaggaaagacttaaa
atgtatgatgaacaaaaacaatatttaatgtccaaaaatattatcaaggattatgacgat
taa

DBGET integrated database retrieval system