KEGG   Plasmodium falciparum 3D7: PF14_0038Help
Entry
PF14_0038         CDS       T00095                                 

Definition
cytochrome c, putative
Orthology
K08738  
cytochrome c
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PF14_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:complement(join(145134..145378,145547..145649))
Genome map
AA seq 115 aa AA seqDB search
MSRPEPQVQVPEGDYKKGAKLFKAKCAQCHTINKGGAVKQGPNLHGFYGRKSGDSDFPYS
DANKNSGIIWSDKHLFEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggcctgaaccacaagtacaagttcctgaaggtgactataaaaagggcgctaag
ctttttaaagcaaaatgtgctcagtgtcatacaattaataagggtggtgctgtgaagcaa
ggacctaatttgcacggattttatggaagaaaatcaggagactccgattttccttattca
gatgctaataaaaattcaggtattatatggtcagataaacatttatttgaatatttgtta
aaccctaaattgtatattccaggaactaaaatgatttttgctggtattaagaaagaaaag
gaacgagcagacttaatagaatatttgaagaaggcttcttcagaataa

DBGET integrated database retrieval system