KEGG   Plasmodium falciparum 3D7: PF14_0142Help
Entry
PF14_0142         CDS       T00095                                 

Gene name
PP1
Definition
serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PF14_0142 (PP1)
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PF14_0142 (PP1)
Protein phosphatases and associated proteins [BR:pfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PF14_0142 (PP1)
Transcription machinery [BR:pfa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PF14_0142 (PP1)
Spliceosome [BR:pfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PF14_0142 (PP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:join(575495..575759,575865..576188,576397..576548,576744..576878,577016..577054)
Genome map
AA seq 304 aa AA seqDB search
MALEIDIDNVISKLIEVRGTRPGKNVNLTENEIKILCLSSREIFLNQPILLELEAPIKIC
GDIHGQFYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
GNHECASINRIYGFYDECKRRYSVKLWKTFIDCFNCLPVAAIIDEKIFCMHGGLSPELNN
MEQIRKITRPTDVPDNGLLCDLLWSDPEKEINGWGENDRGVSFTFGQDVVHNFLRKHELD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK
KAAN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaatagatatagataatgtaatatcaaaactaatagaagttcgtggaact
agaccaggaaaaaatgttaatttgacagaaaatgaaataaaaatattatgtttatcaagt
agggaaatatttttaaaccaaccaattttattagaattagaagcaccaataaaaatatgt
ggagatatccatggacagttttatgatttgttaaggttatttgaatatggtggatttcca
cccgatgcaaattatctatttttaggtgattatgtggatagaggaaaacaaagtttagaa
accatttgtttattattagcatataaaataaaatatcctgaaaatttttttttattaaga
ggtaaccacgaatgcgcttcaataaatagaatatacggattctatgacgaatgtaaaaga
agatatagtgtgaaattatggaaaacatttattgattgctttaattgcttacctgtggca
gctattattgacgaaaaaattttttgtatgcatggtggtttatcacctgaattaaataat
atggaacaaataaggaaaataactaggcctactgatgttcctgataatggtttattatgt
gatttattgtggtctgatccagaaaaagaaattaatgggtggggagaaaatgatcgagga
gtttcttttacctttggtcaagatgttgttcataactttttaagaaaacacgaattagat
ttaatatgcagggcacatcaggtcgtggaggatggatatgaattttttgcaaagcgccaa
ttagttacattattttctgctcctaattattgtggagagtttgataatgccggtgcaatg
atgagtgttgacgagacattaatgtgttcgtttcaaattttaaaaccagtggaaaaaaag
aaagcagcaaattaa

DBGET integrated database retrieval system