KEGG   Plasmodium falciparum 3D7: PF14_0309Help
Entry
PF14_0309         CDS       T00095                                 

Definition
protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase, putative
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PF14_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
14:complement(join(1290410..1290831,1291004..1291157,1291303..1291449))
Genome map
AA seq 240 aa AA seqDB search
MNEKNKDINKYTSTNNMYKLSENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIP
YIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLEN
KNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIH
VGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNGKIIKDRLFDVCFVSLKKN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaaataaggatatcaacaaatatacctcgacaaataatatgtacaaatta
tctgaaaataatcataaaagtttacttgagaatctgaaaagaagggggattattgatgat
gatgatgtgtacaatactatgttacaggttgatagaggaaaatatattaaagaaataccc
tacatagacactcctgtttatattagtcatggggtaaccatatctgcgcctcatatgcac
gctctgtccttgaaaagattaattaatgtgttaaaacctggatctagggccattgatgtt
ggatcgggttcaggttatctaacagtctgtatggccataaaaatgaacgtacttgaaaat
aagaattcttatgttataggattagaacgtgtaaaagatttagtaaacttttcattagaa
aatataaaaagagataaaccagaattgttaaaaattgataattttaaaattattcataaa
aatatttatcaagtaaatgaagaagaaaaaaaagaattaggattattcgatgccattcat
gttggagcgtcagctagcgaacttcctgagattctagtggacctcctagcagaaaacggg
aaattgattatacccatagaagaagattatacacaagttttatatgaaataacaaaaaaa
aatgggaaaattataaaagatagactatttgatgtttgttttgtttccttaaaaaaaaat
taa

DBGET integrated database retrieval system