KEGG   Plasmodium falciparum 3D7: PF14_0346Help
Entry
PF14_0346         CDS       T00095                                 

Gene name
PKG
Definition
cGMP-dependent protein kinase (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pfa  Plasmodium falciparum 3D7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:complement(join(1490597..1492453,1492718..1493148,1493318..1493492,1493697..1493766,1494129..1494157))
Genome map
AA seq 853 aa AA seqDB search
MEEDDNLKKGNERNKKKAIFSNDDFTGEDSLMEDHLELREKLSEDIDMIKTSLKNNLVCS
TLNDNEILTLSNYMQFFVFKSGNLVIKQGEKGSYFFIINSGKFDVYVNDKKVKTMGKGSS
FGEAALIHNTQRSATIIAETDGTLWGVQRSTFRATLKQLSNRNFNENRTFIDSVSVFDML
TEAQKNMITNACVIQNFKSGETIVKQGDYGDVLYILKEGKATVYINDEEIRVLEKGSYFG
ERALLYDEPRSATIIAKEPTACASICRKLLNIVLGNLQVVLFRNIMTEALQQSEIFKQFS
GDQLNDLADTAIVRDYPANYNILHKDKVKSVKYIIVLEGKVELFLDDTSIGILSRGMSFG
DQYVLNQKQPFKHTIKSLEVCKIALITETCLADCLGNNNIDASIDYNNKKSIIKKMYIFR
YLTDKQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEIVKNKKRLRTLGKNDY
FGERALLYDEPRTASVISKVNNVECWFVDKSVFLQIIQGPMLAHLEERIKMQDTKVEMDE
LETERIIGRGTFGTVKLVHHKPTKIRYALKCVSKRSIINLNQQNNIKLEREITAENDHPF
IIRLVRTFKDSKYFYFLTELVTGGELYDAIRKLGLLSKSQAQFYLGSIILAIEYLHERNI
VYRDLKPENILLDKQGYVKLIDFGCAKKVQGRAYTLVGTPHYMAPEVILGKGYGCTVDIW
ALGICLYEFICGPLPFGNDEEDQLEIFRDILTGQLTFPDYVTDTDSINLMKRLLCRLPQG
RIGCSINGFKDIKDHPFFSNFNWDKLAGRLLDPPLVSKSETYAEDIDIKQIEEEDAEDDE
EPLNDEDNWDIDF
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagatgataatctaaaaaaagggaatgaaagaaataaaaagaaggctatattt
tcaaatgatgattttacaggagaagatagtttaatggaggatcatttagaacttcgggaa
aagctttcagaagatattgatatgataaagacttccttaaaaaataatctagtttgtagt
acattaaacgataatgaaatattgactctgtctaattatatgcaattctttgtttttaaa
agtggaaatttagtaataaaacaaggggaaaaagggtcatactttttcattattaatagt
ggcaaatttgacgtttatgtaaatgataaaaaagtaaagactatgggaaaaggtagttct
ttcggtgaagctgctttaattcataatacccaaagaagtgcaactattattgcagaaact
gatggaactctatggggagttcaaagaagtacatttagagctaccctaaaacaattatct
aatagaaattttaacgaaaacagaacatttatcgattccgtttcagtttttgatatgtta
actgaagcacaaaaaaacatgattactaatgcttgtgtaatacaaaactttaaatctggt
gaaaccattgttaaacaaggagattatggagatgtcttatacattttgaaagaaggaaag
gctacagtatatattaacgatgaagagataagggttttagagaaaggttcctattttggg
gaaagagctctactgtatgatgaaccaagaagtgcaacaatcattgcaaaagaaccaacc
gcttgtgcatccatttgtaggaaattattaaatattgttctaggaaacttacaagtagtt
ttatttcgtaatattatgactgaagctttacaacagagtgaaatttttaaacaatttagt
ggggatcaattaaacgatttagcagataccgccattgttcgagattatccagctaattat
aatatattacataaggataaggtaaaatccgttaaatatattattgtattggaaggtaaa
gtagaattatttcttgatgatacttctattggtatattatccagaggaatgtcttttgga
gatcaatatgtattaaatcagaaacaaccatttaagcatactattaaatcattagaagtt
tgtaaaatcgcattaataacggaaacttgtttagctgattgtctaggaaataataatatt
gatgcatctattgattataataataaaaaaagtattataaagaaaatgtatatctttaga
tacttaactgataaacaatgtaatttattaattgaagcttttagaaccacaagatatgaa
gaaggtgattatataatacaagaaggagaagtaggatctagattttatataataaaaaat
ggagaagtagaaatagtaaaaaataaaaaaaggttacgtaccttaggaaagaatgattac
tttggtgaaagagctttattatatgatgaaccaagaacagcttctgttataagtaaagta
aataatgttgaatgttggtttgttgataaaagtgtgtttttacaaattatacaaggacct
atgttagcacatttggaagaaagaataaaaatgcaagatactaaagtagaaatggatgaa
ctagaaacagaacgaattattggaagaggtactttcggaacagttaaattagttcatcat
aaaccaacaaaaataagatatgctttaaaatgtgttagtaaaagaagtattattaattta
aatcaacaaaacaatataaaattagaaagagaaataacagcagaaaatgatcatccattt
attataagattagtaagaacatttaaagattctaaatatttctattttctaacagaatta
gtaacaggtggagaattatatgatgctattagaaaattaggtttattatctaaatcacaa
gctcaattttatttaggttctatcattttagctattgaatatttacatgaaagaaatatt
gtatatagagatttaaaaccagaaaacattttattagataaacaaggttatgtaaaacta
atcgattttggttgtgccaaaaaggtacaaggtagagcttatacattagtaggtacacct
cattatatggcacctgaggttattttaggaaaaggttatggatgtactgttgacatatgg
gcattgggaatatgcctatatgaatttatatgtggtccattaccatttggtaatgatgaa
gaagatcaattagaaattttccgtgatatattaaccggccaacttacatttccagattat
gtaacagacacagatagcataaatttgatgaaaagacttctatgtagattacctcaagga
agaattggttgttcaataaatggcttcaaagacataaaggatcacccatttttctcaaac
tttaattgggataaattggctggtcgtttgcttgatccgcctttagtatcaaaaagtgaa
acttatgcagaagatattgatattaaacaaatagaggaggaggatgctgaggatgatgag
gaaccattgaacgatgaagacaactgggacatagatttttaa

DBGET integrated database retrieval system