KEGG   Plasmodium falciparum 3D7: PF14_0378Help
Entry
PF14_0378         CDS       T00095                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PF14_0378
   01230 Biosynthesis of amino acids
    PF14_0378
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF14_0378
   00051 Fructose and mannose metabolism
    PF14_0378
   00562 Inositol phosphate metabolism
    PF14_0378
Enzymes [BR:pfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PF14_0378
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PF14_0378
  Exosomal proteins of bladder cancer cells
   PF14_0378
  Exosomal proteins of melanoma cells
   PF14_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
14:join(1622519..1622630,1622921..1623555)
Genome map
AA seq 248 aa AA seqDB search
MARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFS
TGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNN
LKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILAYEPLWAIGTGKTATPEQ
AQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESF
VDIIKSAM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaaatattttgtcgcagcaaactggaaatgtaatggaactttagaaagtatt
aaatctttaacaaacagttttaacaatttggattttgatccaagcaaattagacgttgtt
gtttttcctgtttccgtacattatgatcatacaaggaaattacttcagagtaagttttct
actggtattcagaatgtatcaaaattcggaaatggatcatacacaggtgaagtaagtgca
gaaattgccaaggatttaaatattgaatatgttattattggtcattttgaaagaagaaaa
tatttccatgaaaccgatgaagatgttcgtgaaaaattacaagcttcattaaaaaataat
ttaaaagccgttgtatgttttggtgaatctttagaacaaagagaacaaaataaaactatc
gaagttattacaaaacaagttaaagcatttgttgatttaattgataattttgataatgtt
attttggcttatgaacctttatgggctattggtactggtaaaacagctacacctgaacaa
gctcaattagtacacaaagaaatcagaaaaattgtaaaagatacatgcggagaaaaacaa
gctaaccaaataagaatattatatggaggtagtgttaatactgaaaactgctcttcatta
attcaacaagaagatattgatggtttcttagttggaaatgcttccttaaaagaatctttt
gttgatataataaaaagtgctatgtaa

DBGET integrated database retrieval system