KEGG   Plasmodium falciparum 3D7: PF14_0381Help
Entry
PF14_0381         CDS       T00095                                 

Gene name
PBGS, ALAD
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PF14_0381 (PBGS)
Enzymes [BR:pfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PF14_0381 (PBGS)
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PF14_0381 (PBGS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:join(1639420..1639536,1639624..1639671,1640022..1640252,1640430..1640771,1640951..1641215,1641351..1641703)
Genome map
AA seq 451 aa AA seqDB search
MLKSDVVLLLYILIINLICCLNGNSKKRAYILNTPKSSNCKRSSFRRWNNPVNNNNSQIL
SKNEGSIEDVYNKKISGRCNIKNFSKDINNNIYIETNRRERRIKRNKYLLSLYNNTNIKT
SNFIYPLFIHEEDVEKKHTQLEGIYTYNVDGIIKEIEECIKLNIHHFMFFPVIREENKTV
YCEESYNENSYFCKTISRIKEKFSDDIIVYTDVALDPYNIYGHDGIYDDNKKEILNDITV
HTLVKQSLCLAKSGADVVCPSDSMDKRIELIRKNLDFHNFRDILILSYTCKYSSSMYKPF
RSILNSNILKNFVKNKQSYQHDFNSYMDLNNVDKHIIEGADIIMVKPSMFYLDIIHKIKN
RIKDDVQIPIAVYNVSGEYMMIKNYVKYLNEDINYENEIITELFKSYLRAGANIIITYFA
KQYGLYMKKLYDKNIIIDDNSNNNFNIELTL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatcagatgtagtgcttttattgtatatacttataataaatttaatttgttgt
cttaatgggaactctaagaaaagagcttatattttaaatacacctaaatcttcaaattgt
aagagatcaagtttcagaagatggaataatcccgtgaataataataattcacaaatatta
agtaaaaatgaaggatcaattgaagatgtatataacaaaaagatcagtggaagatgtaat
ataaaaaacttctcaaaggatattaacaataatatatatatagaaactaatagaagggaa
agacgtataaagaggaataagtatttactttcattgtataataacacaaatataaagaca
tcgaactttatttatccattatttatacacgaagaagatgtggaaaagaaacatactcaa
ttagagggtatttatacttataacgtagatggtataataaaagaaatagaggaatgtata
aaattaaatattcatcattttatgttctttccagtaataagggaagaaaataaaacagtg
tattgtgaagaatcatataacgaaaacagctacttttgtaaaaccatatcacgaattaaa
gaaaaattttcagatgacattatagtatatacagatgtggcattagatccatataacata
tatggacatgatggaatatatgatgacaacaaaaaggaaatactcaatgatattactgtt
catacgcttgttaagcagtctttatgtttggctaagagtggagctgatgttgtttgcccg
agtgattctatggacaaaagaattgaactgataagaaaaaatttggactttcataatttt
agagatattttaattttatcttatacatgcaaatattcctctagtatgtataagccgttt
cgatcaatcttaaattctaacatattgaaaaattttgttaaaaacaagcaatcttatcag
cacgattttaatagttatatggacctaaacaatgtggataaacatattatagagggggct
gatataataatggtaaaaccatcaatgttttatttagacataatacacaaaataaaaaat
cgaattaaagatgatgtacaaattcctattgctgtttataacgtttctggtgaatatatg
atgataaagaattatgtgaaatatttaaatgaagatataaattatgaaaatgaaataata
acagaattattcaaaagttatttaagagctggtgctaatattatcataacatactttgct
aagcagtatggtttatatatgaaaaaattatatgataaaaatataataattgatgataat
tcaaataataattttaatatagaattaactctatga

DBGET integrated database retrieval system