KEGG   Plasmodium falciparum 3D7: PF14_0431Help
Entry
PF14_0431         CDS       T00095                                 

Gene name
LAMMER
Definition
serine/threonine kinase-1, PfLammer
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pfa  Plasmodium falciparum 3D7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
14:complement(1862718..1865363)
Genome map
AA seq 881 aa AA seqDB search
MTELNIIDNNEKHSKYKLYKYCRNYINDFKNKYMMGYSSNLYKNSPNKYYYDTRNNSNNN
NNGYYYHNYNNGYQIRNKRNRSFETVSNSKNKHKISKKYKYNNEPHESFRDYDYKSKPSY
SSVKKIYDREQKRYNKMFVESRYNENHKNKYINNYNLSRKRNYYSYKKKIYTDRRNFDTH
FGQGNIIYNNEYYLINDGSSLNKKRLHYAKGSFRSRSRSKNYNTYNLEKSKKMKYSSRHN
IYRYHNGNKNKSISRWEDNYTYKDIYQPSSSLHKYKRRSNFTRDDNSIKSKMYYENKKTD
HLYSYEDKYYNKYDDKYDDKYDDKYDDKYDDKYDDKYDDKYDDKYDDKYDDNYDDKYDYG
EEEHRQEYYKKKKISFNNSTNNKSSINYDDVKRELKKRKKKKYSNESKVYDSLKRDETNH
HTNNNSYLNEINKKNSNLSNNYVAVRNKKRDKEYISDSNKSGFSNKGSYYMQKKKLHVDK
YDNDSHNRTISRTSSDNYSRKKYTHKRNRTKTSDTEDKKERKKKKKKKENNESDDEIVHF
SWKKGMLLNNAFLVIRKMGDGTFGRVLLCQHIDNKKYYAVKVVRNIKKYTRSAKIEADIL
KKIQNDDINNNNIVKYHGKFMYYDHMCLIFEPLGPSLYEIITRNNYNGFHIEDIKLYCIE
ILKALNYLRKMSLTHTDLKPENILLDDPYFEKSLITVRRVTDGKKIQIYRTKSTGIKLID
FGCATFKSDYHGSIINTRQYRAPEVILNLGWDVSSDMWSFGCVLAELYTGSLLFRTHEHM
EHLAMMESIIQPIPKNMLYEATKTNGSKYVNKDELKLAWPENASSINSIKHVKKCLPLYK
IIKHELFCDFLYSILQIDPTLRPSPAELLKHKFLEENYEYY
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattgaatattattgataataatgaaaaacatagtaaatataaattatataaa
tattgtagaaattatataaatgattttaaaaataaatatatgatgggttattcatcgaat
ttgtataaaaatagtcccaacaaatattactacgatacgcgaaataatagtaataataat
aataatggttattattaccataattataataatggttatcaaatacgaaataaaagaaat
cgtagttttgagactgtaagtaattcaaaaaacaaacataaaatttcaaaaaaatataaa
tataataatgaaccccatgaaagttttagagactatgattacaaaagtaaacctagttat
tcttctgtaaaaaaaatttatgatagagaacagaagcgttataacaagatgtttgtggaa
tcaaggtataatgaaaatcataagaataaatatataaataattacaatctatcaaggaaa
agaaattattattcttataaaaaaaaaatatatactgatagaagaaattttgatacgcat
tttggacaaggtaatataatatataataatgaatattacttaataaatgatggttcaagt
ttaaataaaaaaaggttgcattatgctaagggtagttttagaagtagatcccgaagcaaa
aattataatacctataatttggaaaagtcaaagaaaatgaaatatagtagtagacataac
atttatagatatcataatggaaataaaaataaatccatctcaagatgggaagataattat
acatacaaagatatatatcaaccctcaagttccttgcataaatacaaaaggaggagtaat
tttacgagggatgacaattctataaaatcgaagatgtattatgaaaataaaaagacggat
cacctttatagttatgaggacaaatattacaacaagtatgatgacaagtatgatgacaag
tatgatgacaagtatgatgacaagtatgatgacaaatatgatgacaaatatgatgacaaa
tatgatgacaaatatgatgataaatatgatgacaattatgatgacaagtatgattatgga
gaagaagaacatagacaagaatattataagaagaaaaaaatatcttttaataatagtact
aataataagagtagtataaattatgatgatgttaaaagagaattaaagaaaaggaaaaaa
aaaaaatattcaaatgaatccaaagtttatgattcattaaaaagagatgaaactaatcat
catactaataataattcttatttaaatgagataaataaaaaaaattcgaatttatcaaat
aattatgtagcagtaagaaataaaaaaagagataaagaatatatcagtgatagtaataaa
agtgggttttcaaataaaggtagctattatatgcaaaagaaaaaattgcatgtagacaag
tatgataatgattcacataatagaactatttctagaacgtcgtccgataattattctaga
aaaaaatatacacataaaagaaataggacgaaaacatctgatacagaagataaaaaagaa
aggaaaaagaagaaaaaaaaaaaggaaaataatgaatcagatgatgaaattgtccatttt
agttggaagaaaggtatgctattaaataatgcctttttagttataagaaaaatgggagat
gggacatttggtagagttttattatgtcaacatatagataataaaaaatactacgctgta
aaagttgttcgaaacataaagaaatatacacgctcagctaaaattgaagcagatatttta
aaaaaaatacaaaatgatgatattaataataataatattgttaagtatcatgggaaattt
atgtattatgaccatatgtgtttaatatttgaaccattaggtccatcattatatgaaata
attacaaggaataattataacggattccatatagaagatattaaattatattgtatagaa
atattaaaagctttaaattatttacgtaaaatgtctttaacgcatacagatttaaaacct
gaaaatattttattagatgatccatattttgaaaaatcattaataactgttagaagggtt
actgatggaaaaaaaatacaaatttatagaaccaagtctactggtataaaattaattgat
tttggttgcgccacatttaaaagtgattatcatggttctattattaacactagacaatat
cgagctccagaagttatattaaatttgggttgggatgtatctagtgatatgtggagtttt
ggttgtgttttggctgaattatatacaggttctttattatttagaacccatgaacatatg
gaacatctggctatgatggaaagtattattcaacctataccaaaaaatatgttatatgaa
gcaaccaaaacaaatggatccaaatatgttaataaggatgagttgaaattagcttggcca
gaaaatgcatccagtattaattctattaaacatgttaaaaaatgtttacccttgtataaa
ataattaaacatgaactattttgtgatttcttatattccatattacaaatagatccaaca
cttcgaccgtcacccgccgaattattaaagcacaagttccttgaagaaaattatgagtac
tattaa

DBGET integrated database retrieval system