KEGG   Plasmodium falciparum 3D7: PF14_0492Help
Entry
PF14_0492         CDS       T00095                                 

Definition
protein phosphatase 2b regulatory subunit, putative
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pfa  Plasmodium falciparum 3D7
Brite
Protein phosphatases and associated proteins [BR:pfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PF14_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:complement(join(2118883..2118930,2119024..2119104,2119225..2119370,2119569..2119653,2119860..2120028,2120212..2120216))
Genome map
AA seq 177 aa AA seqDB search
MGNTQAILSEKDQKDLLQAANFSETDIKKMYKRFIELDTNKNGQLDPNELFDVPEICDNP
LVKRVISIFDSNSDGKVSFVEFLVGITKLASSTDDFQKKKFAFDVYDINKDGMISNGELF
TVMKMMVGNNLNDTQLQQLVDRTILQADKDGDGMISFEEFKDMISHMDVGNKLKLEL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacacaagcgatattatctgaaaaagatcaaaaagatttattacaagcagct
aattttagtgaaacagatatcaaaaaaatgtataaaagatttatagaacttgatacaaat
aaaaatggacagttagatcctaatgaattatttgatgttcctgaaatatgtgataatccc
ctagttaaaagggttatatcaatatttgattcaaattcagatggaaaagtttcatttgta
gaatttttagttggaataacaaaattagcatctagtactgatgatttccagaagaagaaa
tttgcctttgatgtatacgatattaataaagatggaatgatatctaatggagaattattt
accgttatgaaaatgatggttggtaataatttgaacgatacacagttacaacaattagta
gatcgaactatattacaagcagataaagatggtgacggaatgatatcctttgaagaattt
aaagatatgatatcacatatggatgttggaaataaattgaagctagaattataa

DBGET integrated database retrieval system