KEGG   Plasmodium falciparum 3D7: PF14_0492Help
Entry
PF14_0492         CDS       T00095                                 

Definition
(RefSeq) protein phosphatase 2b regulatory subunit, putative
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pfa  Plasmodium falciparum 3D7
Brite
Protein phosphatases and associated proteins [BR:pfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PF14_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 EF-hand_4 MotA_activ
Motif
Other DBs
NCBI-GeneID: 812074
NCBI-ProteinID: XP_001348666
PlasmoDB: PF14_0492
GeneDB: PF14_0492
UniProt: Q8IKV9 Q86RA7
Position
14:complement(join(2118883..2118930,2119024..2119104,2119225..2119370,2119569..2119653,2119860..2120028,2120212..2120216))
Genome map
AA seq 177 aa AA seqDB search
MGNTQAILSEKDQKDLLQAANFSETDIKKMYKRFIELDTNKNGQLDPNELFDVPEICDNP
LVKRVISIFDSNSDGKVSFVEFLVGITKLASSTDDFQKKKFAFDVYDINKDGMISNGELF
TVMKMMVGNNLNDTQLQQLVDRTILQADKDGDGMISFEEFKDMISHMDVGNKLKLEL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacacaagcgatattatctgaaaaagatcaaaaagatttattacaagcagct
aattttagtgaaacagatatcaaaaaaatgtataaaagatttatagaacttgatacaaat
aaaaatggacagttagatcctaatgaattatttgatgttcctgaaatatgtgataatccc
ctagttaaaagggttatatcaatatttgattcaaattcagatggaaaagtttcatttgta
gaatttttagttggaataacaaaattagcatctagtactgatgatttccagaagaagaaa
tttgcctttgatgtatacgatattaataaagatggaatgatatctaatggagaattattt
accgttatgaaaatgatggttggtaataatttgaacgatacacagttacaacaattagta
gatcgaactatattacaagcagataaagatggtgacggaatgatatcctttgaagaattt
aaagatatgatatcacatatggatgttggaaataaattgaagctagaattataa

DBGET integrated database retrieval system