KEGG   Plasmodium falciparum 3D7: PF14_0576Help
Entry
PF14_0576         CDS       T00095                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PF14_0576
Peptidases [BR:pfa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PF14_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
14:join(2461257..2461388,2461603..2461656,2461791..2461862,2462045..2462117,2462200..2462267,2462403..2462483,2462594..2462647,2462774..2462833,2462936..2463040)
Genome map
AA seq 232 aa AA seqDB search
MAKNDIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVND
NIVSENNTNDKHNLKENFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFF
NKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDG
RKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPNDNFDII
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaatgatatttggacacctttagagtccaatcccgattctttatatttatat
tcttgtaaacttggacagtcaaaattaaaatttgtggacatctatggttttaataatgat
ttattggatatgattccacaacctgttcaagcggttatatttttatatcctgtaaatgat
aatatagtttctgaaaacaataccaatgataagcacaatttgaaagaaaattttgataac
gtctggtttataaaacaatacattccaaactcatgtggaaccatagccttgttacattta
tacggaaatttaaggaataaattcgaactagataaggattctgttttggatgatttcttt
aataaagttaatgagatgtctgccgaaaaaagaggacaggagttgaaaaataacaaaagt
attgaaaatttacatcacgagttttgtggacaagtcgagaatagggacgatattttagac
gttgatacacattttattgtttttgtgcaaattgaaggaaagatcattgaattggatgga
agaaaggatcatcctactgttcactgttttaccaatggagataattttttatatgatacg
gggaaaatcatacaagataagtttattgaaaaatgtaaagatgatttaagattttcagca
ttggccgtaataccaaacgataactttgatattatatga

DBGET integrated database retrieval system