KEGG   Plasmodium falciparum 3D7: PF14_0605Help
Entry
PF14_0605         CDS       T00095                                 

Gene name
cyc-1
Definition
cyclin homologue
Orthology
K06634  
cyclin H
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PF14_0605 (cyc-1)
  Replication and repair
   03420 Nucleotide excision repair
    PF14_0605 (cyc-1)
Transcription machinery [BR:pfa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PF14_0605 (cyc-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:2581478..2582458
Genome map
AA seq 326 aa AA seqDB search
MNYPEDTTHMKKWFFKSRKEIDNICLKKYNDFKEEFKDYNIKIPKYNDVEKTKVYFCYQL
VHFCEIKMLRPHIVECATILYNRFYLKEIILEYDPRILIFTCIVLAIKIEGYGRLYKINE
FFNDIDINLDKVLEHENIVCSSLNFELNFLYTKECIFYIKSQFEKYINKYILEADKIDNS
METIINTICFNASKDCIKLIENFYTTFIYTPSQIALYCFTNNIKKNLNIANADMFILEFI
TNNNQILFQKMKNKIKEMDESYRTYIGLRNTFDDENTTRQIGETLDMCIDIYDILKKKKN
SKKSKKKKLDNKEDNVTEPNKKLQVS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattatccagaagatacaacacatatgaaaaagtggtttttcaaaagtcgaaaagaa
attgataatatatgtttaaaaaaatacaatgattttaaagaagagtttaaagattataat
ataaaaatacctaaatataacgatgtagaaaagacgaaagtatatttttgttatcagtta
gtacatttttgtgaaataaaaatgctaaggccacatattgtagaatgcgcaacaatatta
tataaccgattttatttaaaggaaataatattagaatatgatccacgtatattaatattt
acttgtatagtcttagctataaaaatagaaggatatggtcgtttatataaaataaatgaa
ttttttaatgatattgatataaatttagataaagtattagaacatgaaaatattgtatgt
tcttctttaaattttgaattaaattttttatatactaaagaatgtattttttatataaaa
agccaatttgaaaaatatattaataaatatattttggaagcagacaaaattgataattca
atggaaactattataaacactatttgttttaatgcttcaaaagattgtataaaattaatt
gaaaatttttataccacttttatttatacaccttcacaaatagctttatattgttttact
aataatattaaaaagaatttaaatatcgcaaatgcggatatgtttatcttagagtttatt
acaaacaataaccaaattctctttcaaaaaatgaaaaataaaataaaagaaatggatgaa
agctatagaacttatataggattaagaaatacatttgatgatgaaaatacgaccagacaa
atcggtgaaacactagatatgtgtattgatatatatgatatcttaaagaagaaaaaaaat
tcaaagaaatcaaaaaaaaaaaaactggataataaggaagataatgttactgaacctaat
aagaaactacaagtatcataa

DBGET integrated database retrieval system