KEGG   Plasmodium falciparum 3D7: PF14_0605Help
Entry
PF14_0605         CDS       T00095                                 

Gene name
cyc-1
Definition
(RefSeq) cyclin homologue
  KO
K06634  cyclin H
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03022  Basal transcription factors
pfa03420  Nucleotide excision repair
Module
pfa_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PF14_0605 (cyc-1)
  Replication and repair
   03420 Nucleotide excision repair
    PF14_0605 (cyc-1)
Transcription machinery [BR:pfa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PF14_0605 (cyc-1)
DNA repair and recombination proteins [BR:pfa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     PF14_0605 (cyc-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_N Cyclin_C_2
Motif
Other DBs
NCBI-GeneID: 812187
NCBI-ProteinID: XP_001348779
PlasmoDB: PF14_0605
GeneDB: PF14_0605
UniProt: Q8IKK0
Position
14:2581478..2582458
Genome map
AA seq 326 aa AA seqDB search
MNYPEDTTHMKKWFFKSRKEIDNICLKKYNDFKEEFKDYNIKIPKYNDVEKTKVYFCYQL
VHFCEIKMLRPHIVECATILYNRFYLKEIILEYDPRILIFTCIVLAIKIEGYGRLYKINE
FFNDIDINLDKVLEHENIVCSSLNFELNFLYTKECIFYIKSQFEKYINKYILEADKIDNS
METIINTICFNASKDCIKLIENFYTTFIYTPSQIALYCFTNNIKKNLNIANADMFILEFI
TNNNQILFQKMKNKIKEMDESYRTYIGLRNTFDDENTTRQIGETLDMCIDIYDILKKKKN
SKKSKKKKLDNKEDNVTEPNKKLQVS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattatccagaagatacaacacatatgaaaaagtggtttttcaaaagtcgaaaagaa
attgataatatatgtttaaaaaaatacaatgattttaaagaagagtttaaagattataat
ataaaaatacctaaatataacgatgtagaaaagacgaaagtatatttttgttatcagtta
gtacatttttgtgaaataaaaatgctaaggccacatattgtagaatgcgcaacaatatta
tataaccgattttatttaaaggaaataatattagaatatgatccacgtatattaatattt
acttgtatagtcttagctataaaaatagaaggatatggtcgtttatataaaataaatgaa
ttttttaatgatattgatataaatttagataaagtattagaacatgaaaatattgtatgt
tcttctttaaattttgaattaaattttttatatactaaagaatgtattttttatataaaa
agccaatttgaaaaatatattaataaatatattttggaagcagacaaaattgataattca
atggaaactattataaacactatttgttttaatgcttcaaaagattgtataaaattaatt
gaaaatttttataccacttttatttatacaccttcacaaatagctttatattgttttact
aataatattaaaaagaatttaaatatcgcaaatgcggatatgtttatcttagagtttatt
acaaacaataaccaaattctctttcaaaaaatgaaaaataaaataaaagaaatggatgaa
agctatagaacttatataggattaagaaatacatttgatgatgaaaatacgaccagacaa
atcggtgaaacactagatatgtgtattgatatatatgatatcttaaagaagaaaaaaaat
tcaaagaaatcaaaaaaaaaaaaactggataataaggaagataatgttactgaacctaat
aagaaactacaagtatcataa

DBGET integrated database retrieval system