KEGG   Plasmodium falciparum 3D7: PF14_0641Help
Entry
PF14_0641         CDS       T00095                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PF14_0641
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PF14_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
14:2750894..2752360
Genome map
AA seq 488 aa AA seqDB search
MKKYIYIYFFFITITINDLVINNTSKCVSIERRKNNAYINYGIGYNGPDNKITKSRRCKR
IKLCKKDLIDIGAIKKPINVAIFGSTGSIGTNALNIIRECNKIENVFNVKALYVNKSVNE
LYEQAREFLPEYLCIHDKSVYEELKELVKNIKDYKPIILCGDEGMKEICSSNSIDKIVIG
IDSFQGLYSTMYAIMNNKIVALANKESIVSAGFFLKKLLNIHKNAKIIPVDSEHSAIFQC
LDNNKVLKTKCLQDNFSKINNINKIFLCSSGGPFQNLTMDELKNVTSENALKHPKWKMGK
KITIDSATMMNKGLEVIETHFLFDVDYNDIEVIVHKECIIHSCVEFIDKSVISQMYYPDM
QIPILYSLTWPDRIKTNLKPLDLAQVSTLTFHKPSLEHFPCIKLAYQAGIKGNFYPTVLN
ASNEIANNLFLNNKIKYFDISSIISQVLESFNSQKVSENSEDLMKQILQIHSWAKDKATD
IYNKHNSS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatatttatatatattttttcttcatcacaataactattaatgatttagta
ataaataatacatcaaaatgtgtttccattgaaagaagaaaaaataacgcatatataaat
tatggtataggatataatggaccagataataaaataacaaagagtagaagatgtaaaaga
ataaagttatgcaaaaaggatttaatagatattggtgcaataaagaaaccaattaatgta
gcaatttttggaagtactggtagtataggtacgaatgctttaaatataataagggagtgt
aataaaattgaaaatgtttttaatgttaaagcattgtatgtgaataagagtgtgaatgaa
ttatatgaacaagctagagaatttttaccagaatatttgtgtatacatgataaaagtgta
tatgaagaattaaaagaattggtaaaaaatataaaagattataaacctataatattgtgt
ggtgatgaagggatgaaagaaatatgtagtagtaatagtatagataaaatagttattggt
attgattcttttcaaggattatattctactatgtatgcaattatgaataataaaatagtt
gcgttagctaataaagaatccattgtctctgctggtttctttttaaagaaattattaaat
attcataaaaatgcaaagataatacctgttgattcagaacatagtgctatatttcaatgt
ttagataataataaggtattaaaaacaaaatgtttacaagacaatttttctaaaattaac
aatataaataaaatatttttatgttcatctggaggtccatttcaaaatttaactatggac
gaattaaaaaatgtaacatcagaaaatgctttaaagcatcctaaatggaaaatgggtaag
aaaataactatagattctgcaactatgatgaataaaggtttagaggttatagaaacccat
tttttatttgatgtagattataatgatatagaagttatagtacataaagaatgcattata
cattcttgtgttgaatttatagacaaatcagtaataagtcaaatgtattatccagatatg
caaatacccatattatattctttaacatggcctgatagaataaaaacaaatttaaaacct
ttagatttggctcaggtttcaactcttacatttcataaaccttctttagaacatttcccg
tgtattaaattagcttatcaagcaggtataaaaggaaacttttatccaactgtactaaat
gcgtcaaatgaaatagctaacaacttatttttgaataataaaattaaatattttgatatt
tcctctataatatcgcaagttcttgaatctttcaattctcaaaaggtttcggaaaatagt
gaagatttaatgaagcaaattctacaaatacattcctgggccaaagataaagctaccgat
atatacaacaaacataattcttcatag

DBGET integrated database retrieval system