KEGG   Plasmodium falciparum 3D7: PF14_0664Help
Entry
PF14_0664         CDS       T00095                                 

Gene name
ACC1
Definition
biotin carboxylase subunit of acetyl CoA carboxylase, putative (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PF14_0664 (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PF14_0664 (ACC1)
   00640 Propanoate metabolism
    PF14_0664 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PF14_0664 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PF14_0664 (ACC1)
Enzymes [BR:pfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PF14_0664 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PF14_0664 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:join(2852086..2861718,2861874..2862091,2862252..2862504)
Genome map
AA seq 3367 aa AA seqDB search
MINFFLSLLLFVLFFENLVVSIKYRNIHYIHMPNNAHNKNFNEKENREIYHNVNISGGNT
IYEEPKNKYITLFLSNGKKILHSIFRNNNNNNITICNENTGKNSNINLKNNSENNTKSNS
KNYSRGSSSCLNIQNVSNTYYDKRRIKKDIMNKKVEENLIHDENENNIINDKICCDEKQD
LDKEIHVDEQNEKKSNSTLNNESFISILSNDNSEKKKDMEESNNYSNNFYLNSLEENIIY
PTQHVDCDFNGKWKSHVDDILENDSYYSNMNDNSNKSCISDYELLKTSILLNNTKDDFPL
YENSRKNILTTSGKINKNKNLKERKKKNLNRLFYTLKLTNNFSFKNSKNRRKYTNSYNSG
SSTHSRYVMDNKEYIIYHNNNNNNNNNYNSYSNNCNNMYIQGNKKKYNRLYCKKSANSQE
KDYDKDINLIASDKINSELSQDDLKYNSQIINMPNDHFNIITSDEKENIKKNAYKNYVNY
INERRYGYFDLLEKKNEKIIRKLLIANNGMAALKCILSLKDWLFKKFYDENLIKIIVMAT
DEDIKSNAKYISLADKVIKVPGGKNIHNYANVPLIVELAKSENVDAVWPGWGHSSENPLL
STLLEKENIIFIGPTGNVMEALGDKISANILAQSVEVPVVKWSGDNIRIDKFENNKINDE
LYNNATIHSLDDCIKECKRIGFPVMIKASQGGGGKGIRKVENEYEIKKAYEQVQNELPNS
PIFLMKVCNNVRHIEIQVVGDMYGNVCSLSGRDCTTQRRFQKIFEEGPPSVVPYPIFREM
EKSSIRLTKMIKYRGAGTIEYLYDQINKKYFFLELNPRLQVEHPVSEGITNCNLISIQLQ
VAMGIPLQNIDDIRNLYQIDKIEKIKKKDEQKKEFELTDNLCNDTINKDNINNDNIYKDN
INNDNIYKDNIYKDNINNDNIYKDNIYKDNINNDNIYKDNIYKDNIYNDNIYKDNINNDN
IHHIDNTTNEQNNKNLLHYNNYRNQNLCNNNSIKSLLNYDTNENVNRKYNLLNEHFDFYN
NKPYIKNHVIAARITAENSNDSFKPTSGNVRRINFQNWKDVWGYFSINDGFVHEFSDSQI
GHIFAKGETREVARKNLILALRKLHIDGDIKTGTKYLAKILESKAFIDNNITTNWLDIII
EKKKHVFYNTCHIILLCATIFKLLIYFMNEKGKVEENLDRDDIAIKRDKNYGNVINKNNN
HSGNINNNGEHMCKMKSAYIFDMIFQNIKYPFKGYNIGENLYQLEINGQEIEISAEYDKN
NNKVFSTFNNQTYIYACSEDTLGIHMQLEKDNIFIPNVRNPYHLISNTNGKIVKYLINDG
EEVKKNDDYIEVEAMKMIMTFKSTESGILRHKLSEGTIIKIGDLLGIIEKKDNDKKHIKQ
DNEIQYFNGHLDLSNKYTYELIDNRTIFPNILDDNYNKSCDNSYAFTDNMSLQNSEEHYL
VKDEQKKKKKKNISSILNNNMVSIKTVSNDLTDNINVLRAETLSEEGLKDEIYHGQMCDD
RMCDDQMCDDQMCDDENVVKKNDKEQNKSHKNLKENNMDECTYEDDNYIYMKENQKKKLF
MKQNRKKIFRLFSNDNEKITTALNYLNDKFHCVKNYLSNLNFSSANSVSDSSNSSYQNNK
NNNNNNDNNNNNYNNNNNNNSKNKKKNNSVQYNYSNAKYSNVNMIHKYDKKPFDKSYLMN
EVNSNNVNVLMMKNKNNSTFPLIENLENNISTEIMSSRNTSNEKILHNNISKDNTISEPI
FNNNSSDESNINNITFFNNLSNNGSIRKRNNNNNSSSSNNNNNNNNNNKNNNFKHSYYMD
YNNDNIYWNHVKNEKSKYLLDIPIMKRIEFLLKGYEQDYEKCFDELINKKDIKNVSNWSA
YIINNINDILDTFIQYNILFSKKEFISEIDLYDILYNNIRDKKKQYEIIHAYTYNDLSIK
FIEKILKYILNNINSNLAFDIILDKLKILAEFKGKIFRNIIVLSRHILFLLEGLELIEYI
KIALNYNDNKNMKNGGKLSNNMLLLSNYMKKNNLDFSKMIEYKNNKNDIEIVNMFFKGHS
SNIHMFVPSLIKSNKNSMFLKFYLNNLYKYCNIKSIMVTNNIIKFSINNSEYTNLLIWNE
NDTIDINKILESDIKINNDRYLNTVHIINTNNELCLHPSHSFEGNIIKNKILQKCKKLYI
YNYANNKYGDIYEWKNEDLSKGLVGKYSKDGSINNILPYEEYIFGNEKEILEYYELKNIN
QAIYEKTKIFFGIYKNNKNDNNIRNNVNNNYTSLFGHRVIDFNEIKNTSNEYNNFEEHNY
QDDKFIFNKDIHNILLELKESLNDISRGRLNTLIRDNKISSCIIYHIIVDDMMDIETIKE
AYKVFMIKYNEMILENYVNNIFIKIYRTNKKSCTENAPQIQLERMFKLNVLLNKGGVKKE
RTDRYNVEDDNNKKDNDNKYNCNNNNNDDNKYDCNNNFYYDNKYDCNNNFYHDNKFNCNN
NYYHNYHFVEEINQFPSFQIDTLYMKRKRAREVDTLYAYDFINLINISLNRSNKNRESHK
ICNYINSIKEFKLKSDMICYNSNSDNLKNHAMNIKSAHIPLEKKEEYLFEHFDNLSNYEI
KIRKSLYLSDKLDIGQNKRSVVGLLLNIRTDEYEEGRDVIFIINDISTQGGSFSIFEDEL
FYGISSYAREKKIPRIYISCNSGARIGLYNFLMDKIRIEWKDEQKKELGYKYIYITQDVK
EQIDKEDIIFLTEIIENNEKRYIIDAIVGNLKNPVGVENLRGSGLIAGETSKAYEEIFTL
SYVTGRSVGIGAYLVRLGKRTIQKKGSSLLLTGFNALNKILGENVYVSNEQLGGVNIMMR
NGISQVQVESDQEGMDKIIQWLSYVPRTSNDYYDLIQNIYKENNRKFLQNNNFLITNKQK
TMNTYNNLFIHNNKNVSNSVDIKDNIKNQIDTNINTETNINVQDLNIIKKNGINTKSKQD
ENVYEKKDKVEEIYKDQNTYSTNNSKTSKPNDNSMSSYNFELLHINDMDYDHIDDSNIID
LIKGTQEEQGFLDKNTYFEYMNEWGKGIITGRGKLGSIPVGFIAVNKNLVTQSIPCDPAL
KTKAQKLIQAPCVFFPDNSFKTAQSIEDFNKENLPLFIFANWRGFSGGSMDMFYGILKFG
SMIVNQLVNYKHPVFVYIPISAELRGGSWVVVDETLNSQIIEMYADVNSKGGILEPPGIV
EVKFRYPDIRKLMHSIDTTIIALNEKMARCENDEEKNNIKKDIEIKEKELLPYYLQVCHK
YADLHDMSTCMKAKGVIRKIVPWNKARSFFYYRLMRRLLINILSRKYDNALIKNEEIENI
LNDLNNSEDDDYIVCNRVFNNNILRNLKYDTKDIIYNKTLNDFLKIFKMLSQEQRTEFLN
KINSYEN
NT seq 10104 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttttttttatcattattattgtttgttctattttttgaaaatcttgtagtg
tctataaaatatagaaatattcattatatacacatgcctaacaatgctcataataaaaac
tttaatgaaaaagaaaacagagaaatatatcataatgtaaatatatcaggaggtaataca
atatatgaagaacctaaaaataagtatattactttgtttttatctaatggaaaaaaaatc
ctacattccatttttcgaaataataataataataatataaccatatgtaatgaaaatacg
gggaaaaattcaaacatcaacttgaaaaataattctgagaacaatactaagagcaattct
aagaattattctaggggttcttcatcgtgcttaaatatacagaatgtatccaatacatat
tatgataagagaagaattaaaaaggatattatgaataagaaggttgaggaaaatttgata
catgatgaaaatgaaaataatattattaatgataaaatatgttgtgatgaaaaacaagat
ttggataaagaaattcatgtagatgaacaaaatgaaaagaaatcaaacagtactttaaat
aatgaaagttttataagtatattatcaaatgataattccgagaaaaaaaaagatatggaa
gaaagtaataattattctaataatttttatctcaattctttagaggaaaacataatatat
cctactcaacatgttgactgtgattttaatggaaaatggaaaagtcatgtagatgatatt
ctagagaatgattcctactatagtaatatgaatgataatagtaataaatcttgtataagc
gattatgagttattaaaaacgtctattttattgaataatacaaaggatgattttcctcta
tatgaaaattcaagaaaaaatatattaactacaagtggtaaaataaacaagaataaaaac
ttaaaagaaagaaaaaagaagaatttaaatagattattttacactttaaagttaacaaat
aatttttcatttaaaaatagtaagaatagaagaaaatacacaaatagttataatagtgga
tcctctacacattctcgttatgtcatggataataaggaatatataatttaccataataat
aataataataataataataattacaatagttatagtaataattgtaataatatgtatatt
caaggtaataagaaaaagtataatagactatattgtaaaaaaagtgcgaattcacaagaa
aaggattatgataaggatattaatttaattgcttcagataaaattaatagtgaattgtca
caagatgatttaaaatataattcacagataattaatatgcctaatgaccatttcaatatt
attacttctgatgaaaaagaaaatataaaaaaaaatgcatataaaaattatgttaattat
ataaatgaaagaagatatggttattttgatttattagaaaaaaagaatgaaaaaattata
cgcaaattattaatagctaataatgggatggcagccttaaaatgtatattatcattaaaa
gattggttatttaaaaaattttatgatgagaatttaattaaaattatagttatggcaact
gacgaagatattaaaagtaatgcaaaatatatatcattagcagataaagtaataaaagtt
ccaggaggtaaaaatattcataattatgcaaatgttcctttaattgttgagctagccaaa
agtgagaatgttgatgcagtatggcctggatggggacatagttcagaaaatcccttattg
tctactttgttagaaaaagaaaatataatatttataggtccaactggtaatgttatggaa
gctttaggtgataaaatatctgcgaatatattagctcaaagtgttgaagtacctgtggta
aaatggagtggagataatataagaattgataaatttgagaacaataaaataaatgacgaa
ctatataataatgctacaattcattcattagatgattgtataaaagaatgtaagcgtatt
ggttttcctgttatgataaaagcatcacaaggtggtggtgggaaaggtattcgaaaagtg
gagaatgaatatgaaataaaaaaagcatatgaacaagtacaaaatgaattacctaattct
cctatatttttgatgaaggtttgtaataatgtaagacatattgaaatacaagttgttggt
gatatgtatggaaatgtgtgttctttaagtggtcgtgattgtactacacaaagaagattt
caaaaaatttttgaagaaggaccaccatctgttgtaccatatcctatatttcgagaaatg
gaaaaatcatctatacgattaactaaaatgattaaatatagaggtgctggaactattgaa
tatttgtatgatcaaataaataaaaaatattttttcttagaattaaatccaagattacaa
gtagaacatccagtttctgaaggtataacaaattgtaatttaatatctatccaattacaa
gtagctatgggaattccccttcaaaatatagatgacattcgaaatttatatcaaattgat
aaaatagaaaaaataaaaaaaaaagatgaacaaaaaaaagaattcgaattaaccgataat
ttgtgtaatgatactataaataaggataatataaataatgataatatatataaagataat
ataaataatgataatatatataaagataatatatataaagataatataaataatgataat
atatataaagataatatatataaagataatataaataatgataatatatataaagataat
atatataaagataatatatataatgataatatatataaagataatataaataatgataat
atacatcatatagataatacaacaaatgaacaaaataataagaacttgttacattataat
aattatagaaatcaaaatttatgtaataataattcgatcaaatccttattaaattatgat
acaaatgaaaatgttaatagaaagtataatttattgaatgaacactttgatttttataat
aataaaccatatattaaaaatcatgttattgctgcaaggattacagcagaaaatagtaat
gatagctttaagcccacctctggtaatgtaagaagaataaattttcaaaactggaaagat
gtgtggggatatttttctattaatgatggttttgtacatgagttttcagattctcaaatc
ggacatatttttgctaaaggagaaacaagagaagtagcaagaaaaaatttaattttagca
ttaagaaagttacatattgatggtgatataaaaacaggtacaaaatatttagcaaagatt
ttagaatctaaagcatttattgacaataatattacaacaaattggctagatataataata
gaaaagaaaaaacatgtattttataatacatgtcatataatattattatgtgctaccata
tttaaactattaatatattttatgaatgagaagggaaaagtggaagaaaatttggataga
gatgatatagctataaaaagagataaaaattatggaaatgtaataaataaaaataataac
catagtggtaatataaataataatggggaacatatgtgtaaaatgaaaagtgcatatata
tttgatatgatatttcaaaatataaaatatccttttaaaggatataatataggggaaaat
ctatatcaattagagataaatggacaagaaatagaaatatctgctgaatatgataaaaat
aataataaagtattttctacatttaataatcaaacatatatatatgcatgttctgaggat
accttaggtatacatatgcaactagagaaagataatattttcatacctaatgttaggaat
ccatatcatttaatatctaatactaatgggaaaattgttaagtatttaataaatgatgga
gaagaagttaaaaaaaatgatgattatattgaagtggaagctatgaaaatgattatgaca
tttaaatcaaccgagagtggaatattaagacataaattgtctgaagggacaattattaaa
ataggagatttattaggaataatagaaaaaaaagataatgataaaaaacatataaaacaa
gataatgaaattcaatattttaatggtcatttagatttgtcaaataaatatacatatgaa
ttgatagataatcgtacaatatttccaaatattttagatgataattataataaatcttgt
gataattcgtatgcctttacagataatatgtctttacaaaactctgaagaacattatttg
gtaaaagatgaacaaaaaaaaaaaaaaaaaaaaaatatttcttccattttaaataataat
atggtaagcataaaaacggtatcaaatgatttaacagataatataaatgtgttaagagct
gaaacattgagtgaagagggcttaaaggatgaaatatatcatggtcaaatgtgtgatgat
cgaatgtgtgatgatcaaatgtgtgatgatcaaatgtgtgatgatgaaaatgttgtgaag
aaaaatgataaagaacagaataaatcacataaaaatttaaaagaaaataatatggatgaa
tgtacttatgaagatgataattatatatatatgaaagaaaatcaaaagaaaaaattattt
atgaaacaaaatagaaagaaaatctttcgtttattttcaaatgataatgaaaaaataaca
acggctttaaattatttaaatgataaatttcattgtgtaaaaaattatttgtcaaattta
aatttttctagtgcaaattctgtatcagattctagtaattcatcctatcaaaataataaa
aacaataataataataatgacaacaacaacaataattataataataataataataataat
agtaagaataagaagaaaaataatagtgtgcaatacaattattccaatgctaaatattca
aatgttaatatgatacataagtatgataagaaaccatttgataaaagttatttaatgaat
gaagttaacagtaataatgttaatgtgttaatgatgaaaaataaaaataatagtacgttc
cccttgattgaaaatttagaaaataatatatctacagaaattatgtcttctcgaaatacg
tctaatgaaaaaatattacataataatatatcaaaggataatacaataagcgaaccaatt
tttaataataattcttctgatgagagtaatataaataatattacattttttaataactta
tcaaataatggtagcataagaaaaagaaacaacaataataatagtagtagtagcaataat
aataataataataataataataataaaaataataattttaaacattcctattatatggat
tataataatgataatatctattggaatcatgtaaagaatgaaaaaagcaaatatttgctt
gacattccaattatgaaaagaatagaatttttgctaaagggatatgaacaggattatgaa
aagtgttttgatgaattaataaacaagaaagatattaaaaatgtatcaaattggtctgca
tatataataaacaatataaatgacatattagatacattcatacaatataatattttattt
tccaaaaaagaatttatttcagaaatagatttatatgatatattatataataatataagg
gataagaaaaagcaatatgaaattatacacgcatatacatacaacgatttaagtataaag
tttatagaaaaaatattaaaatatatattaaataatataaatagtaatttagccttcgat
ataattttggataagttaaaaatattagcagaattcaaaggaaaaatctttagaaatata
attgtattatcaagacatattttatttttattagaaggattagaattaattgaatatata
aaaattgcattaaattataatgataataaaaatatgaagaatggtggtaagttatcaaat
aatatgttacttttgtctaattatatgaaaaaaaataatttagatttttcaaaaatgata
gaatataaaaataataaaaatgatatagaaattgtaaatatgttttttaaaggtcatagt
agtaatatacatatgtttgttccatcattaattaaatcaaataaaaattctatgttttta
aaattttatttaaataatttatataaatattgtaatattaaatctataatggtaacaaat
aatataatcaagttttctataaataattcagaatatactaatctattaatatggaatgaa
aatgataccattgatataaataaaattcttgagtcagatataaaaataaataatgataga
tatttgaatactgttcatataataaatacaaataacgaattatgtttacatccttctcat
tcgtttgaaggaaatataataaaaaataagattttacaaaaatgtaaaaaattatatata
tataattatgcaaataataaatatggagatatatatgaatggaaaaatgaagacctatca
aaaggattagtaggaaaatatagtaaagatggaagtattaataatattttaccttatgaa
gaatatatatttggtaatgaaaaagaaatattggaatattatgaattaaaaaatattaat
caagcgatatatgaaaaaacaaagatattttttggtatatataaaaataataaaaatgat
aataatatacgtaataatgttaataataattatacatctttatttggacaccgtgtaata
gattttaatgaaataaaaaacacatcaaatgagtataataattttgaggaacataattat
caagatgataaatttatatttaataaagatatacataatattcttttagaattaaaggaa
tcattaaatgacatatcacgtggaagactaaatacattgataagagataataaaataagt
agttgtataatatatcatattattgttgatgatatgatggatattgaaactataaaagag
gcatataaggtgttcatgattaaatataatgaaatgatattagaaaattatgtcaataat
atatttataaaaatataccgtactaataaaaagtcatgtactgaaaatgcacctcaaatt
caattggaaagaatgtttaagcttaacgtgcttttaaataaaggaggtgtaaagaaagaa
aggacggatagatataatgtggaagatgataataataaaaaggataatgataacaaatat
aattgtaataataataataatgatgataacaaatatgattgtaataataatttttattat
gataacaaatatgattgtaataacaatttttatcatgataacaaatttaattgtaataat
aattattatcataattaccattttgttgaagagattaaccaatttccttctttccaaatt
gacaccctatatatgaagagaaaacgcgctagagaagtagacacattatatgcctatgat
tttattaatcttataaatatatcattaaacagatcaaataaaaacagagaaagtcataaa
atatgtaattatattaatagtattaaggagtttaaactaaaaagtgatatgatttgttat
aatagtaatagtgataatttaaagaatcatgcaatgaatataaaaagtgcacatattcct
ttggaaaaaaaagaagaatacctatttgaacattttgacaatttaagtaattatgaaata
aaaataaggaagtcattatatttgtctgataaactagatataggacagaacaaaaggagt
gtggttggtttgttgttaaacataagaacagatgaatatgaagaagggagagatgtaata
ttcattattaatgatataagtacacaaggtggatcatttagtatatttgaagatgagcta
ttttatggtatttctagttatgcaagagaaaagaaaattccacgtatatatatatcatgt
aattctggcgctcgtataggattatataattttttaatggataaaataagaattgaatgg
aaagacgaacagaaaaaagaactaggttataaatatatatatataacacaagatgtaaaa
gaacaaatagataaagaagatattatatttttaactgaaattatagaaaataatgaaaaa
agatatattattgatgctattgttgggaatttaaaaaatccagtaggtgtagagaatctc
agaggaagtggattaatagcaggagaaacttcaaaagcgtatgaagaaatttttacatta
tcttatgttactggtcgcagtgttggtattggtgcttatttagttagacttggtaaaagg
acaattcaaaaaaaaggctcttcgcttttgcttacaggttttaatgcattgaataaaata
ttaggtgaaaatgtatatgtaagtaatgaacagttaggtggtgttaatattatgatgagg
aatggtatatctcaagttcaggttgaaagtgatcaagaaggtatggataaaattatacaa
tggttatcttatgttcccagaactagtaatgattattatgatttaatacaaaatatatat
aaagaaaataatagaaaatttctacaaaataataactttttaataacaaataagcaaaag
actatgaatacatataacaacctttttatacataacaataaaaatgtaagtaattctgtc
gatataaaggataacataaagaaccagatagatacaaatataaatacggaaactaatatt
aatgtgcaagatttaaatattattaaaaaaaatgggattaatacaaaatcaaaacaagat
gaaaatgtgtatgaaaagaaagataaagtagaagaaatatataaagatcaaaacacatat
agtacaaataatagcaagacctctaaaccaaatgataattctatgagttcatacaatttt
gaacttttacatataaatgatatggattacgatcatatagatgattctaatattatcgat
ttgatcaagggtactcaagaagaacagggtttcttagataaaaatacctattttgaatat
atgaatgaatggggaaaaggtattataactggtagaggaaaattaggttctatacctgtt
ggatttattgctgttaataaaaatttagttacgcaatctattccatgtgatccagcatta
aaaacaaaagctcaaaaattaatacaagctccatgtgttttttttcctgataattctttt
aaaacagcacaatcaattgaagattttaataaggagaatttgcctttatttatttttgca
aattggagaggattttcaggtggatctatggatatgttttatggtatcttaaaatttgga
tctatgattgtaaatcagctagttaattataaacaccctgtatttgtatatatacctata
tctgctgaattgagaggtggatcatgggtagttgtcgatgaaacattgaatagccaaatt
atagaaatgtatgccgatgtcaatagtaaagggggaatattagaaccaccaggaattgtt
gaagttaagtttagatatcctgatattcgaaaattaatgcacagtattgatactaccata
attgctttgaatgaaaaaatggctagatgtgaaaatgatgaagagaagaacaatataaag
aaagatatagaaattaaggaaaaagagttgttgccatattatttacaagtgtgtcataaa
tatgcagatttacatgacatgtctacatgtatgaaagcaaagggtgtaattcgaaaaatt
gtcccatggaataaggcacgttcgtttttttattatcgtctaatgaggagattattaatt
aacatattgagtcgaaagtatgacaacgctttaatcaaaaatgaagagatagaaaatatt
ttaaatgaccttaataattcagaagatgatgattatattgtatgcaatagagttttcaat
aataatattttacgaaatttaaaatacgataccaaggatataatatataacaaaacatta
aatgactttttaaaaatttttaaaatgctatcacaggaacaaaggacagaatttctaaat
aaaataaattcttatgaaaattaa

DBGET integrated database retrieval system