KEGG   Plasmodium falciparum 3D7: PF14_0664Help
Entry
PF14_0664         CDS       T00095                                 

Gene name
ACC1
Definition
(RefSeq) biotin carboxylase subunit of acetyl CoA carboxylase, putative (EC:6.4.1.2)
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PF14_0664 (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PF14_0664 (ACC1)
   00640 Propanoate metabolism
    PF14_0664 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PF14_0664 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PF14_0664 (ACC1)
Enzymes [BR:pfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PF14_0664 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PF14_0664 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:join(2852086..2861718,2861874..2862091,2862252..2862504)
Genome map
AA seq 3367 aa AA seqDB search
MINFFLSLLLFVLFFENLVVSIKYRNIHYIHMPNNAHNKNFNEKENREIYHNVNISGGNT
IYEEPKNKYITLFLSNGKKILHSIFRNNNNNNITICNENTGKNSNINLKNNSENNTKSNS
KNYSRGSSSCLNIQNVSNTYYDKRRIKKDIMNKKVEENLIHDENENNIINDKICCDEKQD
LDKEIHVDEQNEKKSNSTLNNESFISILSNDNSEKKKDMEESNNYSNNFYLNSLEENIIY
PTQHVDCDFNGKWKSHVDDILENDSYYSNMNDNSNKSCISDYELLKTSILLNNTKDDFPL
YENSRKNILTTSGKINKNKNLKERKKKNLNRLFYTLKLTNNFSFKNSKNRRKYTNSYNSG
SSTHSRYVMDNKEYIIYHNNNNNNNNNYNSYSNNCNNMYIQGNKKKYNRLYCKKSANSQE
KDYDKDINLIASDKINSELSQDDLKYNSQIINMPNDHFNIITSDEKENIKKNAYKNYVNY
INERRYGYFDLLEKKNEKIIRKLLIANNGMAALKCILSLKDWLFKKFYDENLIKIIVMAT
DEDIKSNAKYISLADKVIKVPGGKNIHNYANVPLIVELAKSENVDAVWPGWGHSSENPLL
STLLEKENIIFIGPTGNVMEALGDKISANILAQSVEVPVVKWSGDNIRIDKFENNKINDE
LYNNATIHSLDDCIKECKRIGFPVMIKASQGGGGKGIRKVENEYEIKKAYEQVQNELPNS
PIFLMKVCNNVRHIEIQVVGDMYGNVCSLSGRDCTTQRRFQKIFEEGPPSVVPYPIFREM
EKSSIRLTKMIKYRGAGTIEYLYDQINKKYFFLELNPRLQVEHPVSEGITNCNLISIQLQ
VAMGIPLQNIDDIRNLYQIDKIEKIKKKDEQKKEFELTDNLCNDTINKDNINNDNIYKDN
INNDNIYKDNIYKDNINNDNIYKDNIYKDNINNDNIYKDNIYKDNIYNDNIYKDNINNDN
IHHIDNTTNEQNNKNLLHYNNYRNQNLCNNNSIKSLLNYDTNENVNRKYNLLNEHFDFYN
NKPYIKNHVIAARITAENSNDSFKPTSGNVRRINFQNWKDVWGYFSINDGFVHEFSDSQI
GHIFAKGETREVARKNLILALRKLHIDGDIKTGTKYLAKILESKAFIDNNITTNWLDIII
EKKKHVFYNTCHIILLCATIFKLLIYFMNEKGKVEENLDRDDIAIKRDKNYGNVINKNNN
HSGNINNNGEHMCKMKSAYIFDMIFQNIKYPFKGYNIGENLYQLEINGQEIEISAEYDKN
NNKVFSTFNNQTYIYACSEDTLGIHMQLEKDNIFIPNVRNPYHLISNTNGKIVKYLINDG
EEVKKNDDYIEVEAMKMIMTFKSTESGILRHKLSEGTIIKIGDLLGIIEKKDNDKKHIKQ
DNEIQYFNGHLDLSNKYTYELIDNRTIFPNILDDNYNKSCDNSYAFTDNMSLQNSEEHYL
VKDEQKKKKKKNISSILNNNMVSIKTVSNDLTDNINVLRAETLSEEGLKDEIYHGQMCDD
RMCDDQMCDDQMCDDENVVKKNDKEQNKSHKNLKENNMDECTYEDDNYIYMKENQKKKLF
MKQNRKKIFRLFSNDNEKITTALNYLNDKFHCVKNYLSNLNFSSANSVSDSSNSSYQNNK
NNNNNNDNNNNNYNNNNNNNSKNKKKNNSVQYNYSNAKYSNVNMIHKYDKKPFDKSYLMN
EVNSNNVNVLMMKNKNNSTFPLIENLENNISTEIMSSRNTSNEKILHNNISKDNTISEPI
FNNNSSDESNINNITFFNNLSNNGSIRKRNNNNNSSSSNNNNNNNNNNKNNNFKHSYYMD
YNNDNIYWNHVKNEKSKYLLDIPIMKRIEFLLKGYEQDYEKCFDELINKKDIKNVSNWSA
YIINNINDILDTFIQYNILFSKKEFISEIDLYDILYNNIRDKKKQYEIIHAYTYNDLSIK
FIEKILKYILNNINSNLAFDIILDKLKILAEFKGKIFRNIIVLSRHILFLLEGLELIEYI
KIALNYNDNKNMKNGGKLSNNMLLLSNYMKKNNLDFSKMIEYKNNKNDIEIVNMFFKGHS
SNIHMFVPSLIKSNKNSMFLKFYLNNLYKYCNIKSIMVTNNIIKFSINNSEYTNLLIWNE
NDTIDINKILESDIKINNDRYLNTVHIINTNNELCLHPSHSFEGNIIKNKILQKCKKLYI
YNYANNKYGDIYEWKNEDLSKGLVGKYSKDGSINNILPYEEYIFGNEKEILEYYELKNIN
QAIYEKTKIFFGIYKNNKNDNNIRNNVNNNYTSLFGHRVIDFNEIKNTSNEYNNFEEHNY
QDDKFIFNKDIHNILLELKESLNDISRGRLNTLIRDNKISSCIIYHIIVDDMMDIETIKE
AYKVFMIKYNEMILENYVNNIFIKIYRTNKKSCTENAPQIQLERMFKLNVLLNKGGVKKE
RTDRYNVEDDNNKKDNDNKYNCNNNNNDDNKYDCNNNFYYDNKYDCNNNFYHDNKFNCNN
NYYHNYHFVEEINQFPSFQIDTLYMKRKRAREVDTLYAYDFINLINISLNRSNKNRESHK
ICNYINSIKEFKLKSDMICYNSNSDNLKNHAMNIKSAHIPLEKKEEYLFEHFDNLSNYEI
KIRKSLYLSDKLDIGQNKRSVVGLLLNIRTDEYEEGRDVIFIINDISTQGGSFSIFEDEL
FYGISSYAREKKIPRIYISCNSGARIGLYNFLMDKIRIEWKDEQKKELGYKYIYITQDVK
EQIDKEDIIFLTEIIENNEKRYIIDAIVGNLKNPVGVENLRGSGLIAGETSKAYEEIFTL
SYVTGRSVGIGAYLVRLGKRTIQKKGSSLLLTGFNALNKILGENVYVSNEQLGGVNIMMR
NGISQVQVESDQEGMDKIIQWLSYVPRTSNDYYDLIQNIYKENNRKFLQNNNFLITNKQK
TMNTYNNLFIHNNKNVSNSVDIKDNIKNQIDTNINTETNINVQDLNIIKKNGINTKSKQD
ENVYEKKDKVEEIYKDQNTYSTNNSKTSKPNDNSMSSYNFELLHINDMDYDHIDDSNIID
LIKGTQEEQGFLDKNTYFEYMNEWGKGIITGRGKLGSIPVGFIAVNKNLVTQSIPCDPAL
KTKAQKLIQAPCVFFPDNSFKTAQSIEDFNKENLPLFIFANWRGFSGGSMDMFYGILKFG
SMIVNQLVNYKHPVFVYIPISAELRGGSWVVVDETLNSQIIEMYADVNSKGGILEPPGIV
EVKFRYPDIRKLMHSIDTTIIALNEKMARCENDEEKNNIKKDIEIKEKELLPYYLQVCHK
YADLHDMSTCMKAKGVIRKIVPWNKARSFFYYRLMRRLLINILSRKYDNALIKNEEIENI
LNDLNNSEDDDYIVCNRVFNNNILRNLKYDTKDIIYNKTLNDFLKIFKMLSQEQRTEFLN
KINSYEN
NT seq 10104 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttttttttatcattattattgtttgttctattttttgaaaatcttgtagtg
tctataaaatatagaaatattcattatatacacatgcctaacaatgctcataataaaaac
tttaatgaaaaagaaaacagagaaatatatcataatgtaaatatatcaggaggtaataca
atatatgaagaacctaaaaataagtatattactttgtttttatctaatggaaaaaaaatc
ctacattccatttttcgaaataataataataataatataaccatatgtaatgaaaatacg
gggaaaaattcaaacatcaacttgaaaaataattctgagaacaatactaagagcaattct
aagaattattctaggggttcttcatcgtgcttaaatatacagaatgtatccaatacatat
tatgataagagaagaattaaaaaggatattatgaataagaaggttgaggaaaatttgata
catgatgaaaatgaaaataatattattaatgataaaatatgttgtgatgaaaaacaagat
ttggataaagaaattcatgtagatgaacaaaatgaaaagaaatcaaacagtactttaaat
aatgaaagttttataagtatattatcaaatgataattccgagaaaaaaaaagatatggaa
gaaagtaataattattctaataatttttatctcaattctttagaggaaaacataatatat
cctactcaacatgttgactgtgattttaatggaaaatggaaaagtcatgtagatgatatt
ctagagaatgattcctactatagtaatatgaatgataatagtaataaatcttgtataagc
gattatgagttattaaaaacgtctattttattgaataatacaaaggatgattttcctcta
tatgaaaattcaagaaaaaatatattaactacaagtggtaaaataaacaagaataaaaac
ttaaaagaaagaaaaaagaagaatttaaatagattattttacactttaaagttaacaaat
aatttttcatttaaaaatagtaagaatagaagaaaatacacaaatagttataatagtgga
tcctctacacattctcgttatgtcatggataataaggaatatataatttaccataataat
aataataataataataataattacaatagttatagtaataattgtaataatatgtatatt
caaggtaataagaaaaagtataatagactatattgtaaaaaaagtgcgaattcacaagaa
aaggattatgataaggatattaatttaattgcttcagataaaattaatagtgaattgtca
caagatgatttaaaatataattcacagataattaatatgcctaatgaccatttcaatatt
attacttctgatgaaaaagaaaatataaaaaaaaatgcatataaaaattatgttaattat
ataaatgaaagaagatatggttattttgatttattagaaaaaaagaatgaaaaaattata
cgcaaattattaatagctaataatgggatggcagccttaaaatgtatattatcattaaaa
gattggttatttaaaaaattttatgatgagaatttaattaaaattatagttatggcaact
gacgaagatattaaaagtaatgcaaaatatatatcattagcagataaagtaataaaagtt
ccaggaggtaaaaatattcataattatgcaaatgttcctttaattgttgagctagccaaa
agtgagaatgttgatgcagtatggcctggatggggacatagttcagaaaatcccttattg
tctactttgttagaaaaagaaaatataatatttataggtccaactggtaatgttatggaa
gctttaggtgataaaatatctgcgaatatattagctcaaagtgttgaagtacctgtggta
aaatggagtggagataatataagaattgataaatttgagaacaataaaataaatgacgaa
ctatataataatgctacaattcattcattagatgattgtataaaagaatgtaagcgtatt
ggttttcctgttatgataaaagcatcacaaggtggtggtgggaaaggtattcgaaaagtg
gagaatgaatatgaaataaaaaaagcatatgaacaagtacaaaatgaattacctaattct
cctatatttttgatgaaggtttgtaataatgtaagacatattgaaatacaagttgttggt
gatatgtatggaaatgtgtgttctttaagtggtcgtgattgtactacacaaagaagattt
caaaaaatttttgaagaaggaccaccatctgttgtaccatatcctatatttcgagaaatg
gaaaaatcatctatacgattaactaaaatgattaaatatagaggtgctggaactattgaa
tatttgtatgatcaaataaataaaaaatattttttcttagaattaaatccaagattacaa
gtagaacatccagtttctgaaggtataacaaattgtaatttaatatctatccaattacaa
gtagctatgggaattccccttcaaaatatagatgacattcgaaatttatatcaaattgat
aaaatagaaaaaataaaaaaaaaagatgaacaaaaaaaagaattcgaattaaccgataat
ttgtgtaatgatactataaataaggataatataaataatgataatatatataaagataat
ataaataatgataatatatataaagataatatatataaagataatataaataatgataat
atatataaagataatatatataaagataatataaataatgataatatatataaagataat
atatataaagataatatatataatgataatatatataaagataatataaataatgataat
atacatcatatagataatacaacaaatgaacaaaataataagaacttgttacattataat
aattatagaaatcaaaatttatgtaataataattcgatcaaatccttattaaattatgat
acaaatgaaaatgttaatagaaagtataatttattgaatgaacactttgatttttataat
aataaaccatatattaaaaatcatgttattgctgcaaggattacagcagaaaatagtaat
gatagctttaagcccacctctggtaatgtaagaagaataaattttcaaaactggaaagat
gtgtggggatatttttctattaatgatggttttgtacatgagttttcagattctcaaatc
ggacatatttttgctaaaggagaaacaagagaagtagcaagaaaaaatttaattttagca
ttaagaaagttacatattgatggtgatataaaaacaggtacaaaatatttagcaaagatt
ttagaatctaaagcatttattgacaataatattacaacaaattggctagatataataata
gaaaagaaaaaacatgtattttataatacatgtcatataatattattatgtgctaccata
tttaaactattaatatattttatgaatgagaagggaaaagtggaagaaaatttggataga
gatgatatagctataaaaagagataaaaattatggaaatgtaataaataaaaataataac
catagtggtaatataaataataatggggaacatatgtgtaaaatgaaaagtgcatatata
tttgatatgatatttcaaaatataaaatatccttttaaaggatataatataggggaaaat
ctatatcaattagagataaatggacaagaaatagaaatatctgctgaatatgataaaaat
aataataaagtattttctacatttaataatcaaacatatatatatgcatgttctgaggat
accttaggtatacatatgcaactagagaaagataatattttcatacctaatgttaggaat
ccatatcatttaatatctaatactaatgggaaaattgttaagtatttaataaatgatgga
gaagaagttaaaaaaaatgatgattatattgaagtggaagctatgaaaatgattatgaca
tttaaatcaaccgagagtggaatattaagacataaattgtctgaagggacaattattaaa
ataggagatttattaggaataatagaaaaaaaagataatgataaaaaacatataaaacaa
gataatgaaattcaatattttaatggtcatttagatttgtcaaataaatatacatatgaa
ttgatagataatcgtacaatatttccaaatattttagatgataattataataaatcttgt
gataattcgtatgcctttacagataatatgtctttacaaaactctgaagaacattatttg
gtaaaagatgaacaaaaaaaaaaaaaaaaaaaaaatatttcttccattttaaataataat
atggtaagcataaaaacggtatcaaatgatttaacagataatataaatgtgttaagagct
gaaacattgagtgaagagggcttaaaggatgaaatatatcatggtcaaatgtgtgatgat
cgaatgtgtgatgatcaaatgtgtgatgatcaaatgtgtgatgatgaaaatgttgtgaag
aaaaatgataaagaacagaataaatcacataaaaatttaaaagaaaataatatggatgaa
tgtacttatgaagatgataattatatatatatgaaagaaaatcaaaagaaaaaattattt
atgaaacaaaatagaaagaaaatctttcgtttattttcaaatgataatgaaaaaataaca
acggctttaaattatttaaatgataaatttcattgtgtaaaaaattatttgtcaaattta
aatttttctagtgcaaattctgtatcagattctagtaattcatcctatcaaaataataaa
aacaataataataataatgacaacaacaacaataattataataataataataataataat
agtaagaataagaagaaaaataatagtgtgcaatacaattattccaatgctaaatattca
aatgttaatatgatacataagtatgataagaaaccatttgataaaagttatttaatgaat
gaagttaacagtaataatgttaatgtgttaatgatgaaaaataaaaataatagtacgttc
cccttgattgaaaatttagaaaataatatatctacagaaattatgtcttctcgaaatacg
tctaatgaaaaaatattacataataatatatcaaaggataatacaataagcgaaccaatt
tttaataataattcttctgatgagagtaatataaataatattacattttttaataactta
tcaaataatggtagcataagaaaaagaaacaacaataataatagtagtagtagcaataat
aataataataataataataataataaaaataataattttaaacattcctattatatggat
tataataatgataatatctattggaatcatgtaaagaatgaaaaaagcaaatatttgctt
gacattccaattatgaaaagaatagaatttttgctaaagggatatgaacaggattatgaa
aagtgttttgatgaattaataaacaagaaagatattaaaaatgtatcaaattggtctgca
tatataataaacaatataaatgacatattagatacattcatacaatataatattttattt
tccaaaaaagaatttatttcagaaatagatttatatgatatattatataataatataagg
gataagaaaaagcaatatgaaattatacacgcatatacatacaacgatttaagtataaag
tttatagaaaaaatattaaaatatatattaaataatataaatagtaatttagccttcgat
ataattttggataagttaaaaatattagcagaattcaaaggaaaaatctttagaaatata
attgtattatcaagacatattttatttttattagaaggattagaattaattgaatatata
aaaattgcattaaattataatgataataaaaatatgaagaatggtggtaagttatcaaat
aatatgttacttttgtctaattatatgaaaaaaaataatttagatttttcaaaaatgata
gaatataaaaataataaaaatgatatagaaattgtaaatatgttttttaaaggtcatagt
agtaatatacatatgtttgttccatcattaattaaatcaaataaaaattctatgttttta
aaattttatttaaataatttatataaatattgtaatattaaatctataatggtaacaaat
aatataatcaagttttctataaataattcagaatatactaatctattaatatggaatgaa
aatgataccattgatataaataaaattcttgagtcagatataaaaataaataatgataga
tatttgaatactgttcatataataaatacaaataacgaattatgtttacatccttctcat
tcgtttgaaggaaatataataaaaaataagattttacaaaaatgtaaaaaattatatata
tataattatgcaaataataaatatggagatatatatgaatggaaaaatgaagacctatca
aaaggattagtaggaaaatatagtaaagatggaagtattaataatattttaccttatgaa
gaatatatatttggtaatgaaaaagaaatattggaatattatgaattaaaaaatattaat
caagcgatatatgaaaaaacaaagatattttttggtatatataaaaataataaaaatgat
aataatatacgtaataatgttaataataattatacatctttatttggacaccgtgtaata
gattttaatgaaataaaaaacacatcaaatgagtataataattttgaggaacataattat
caagatgataaatttatatttaataaagatatacataatattcttttagaattaaaggaa
tcattaaatgacatatcacgtggaagactaaatacattgataagagataataaaataagt
agttgtataatatatcatattattgttgatgatatgatggatattgaaactataaaagag
gcatataaggtgttcatgattaaatataatgaaatgatattagaaaattatgtcaataat
atatttataaaaatataccgtactaataaaaagtcatgtactgaaaatgcacctcaaatt
caattggaaagaatgtttaagcttaacgtgcttttaaataaaggaggtgtaaagaaagaa
aggacggatagatataatgtggaagatgataataataaaaaggataatgataacaaatat
aattgtaataataataataatgatgataacaaatatgattgtaataataatttttattat
gataacaaatatgattgtaataacaatttttatcatgataacaaatttaattgtaataat
aattattatcataattaccattttgttgaagagattaaccaatttccttctttccaaatt
gacaccctatatatgaagagaaaacgcgctagagaagtagacacattatatgcctatgat
tttattaatcttataaatatatcattaaacagatcaaataaaaacagagaaagtcataaa
atatgtaattatattaatagtattaaggagtttaaactaaaaagtgatatgatttgttat
aatagtaatagtgataatttaaagaatcatgcaatgaatataaaaagtgcacatattcct
ttggaaaaaaaagaagaatacctatttgaacattttgacaatttaagtaattatgaaata
aaaataaggaagtcattatatttgtctgataaactagatataggacagaacaaaaggagt
gtggttggtttgttgttaaacataagaacagatgaatatgaagaagggagagatgtaata
ttcattattaatgatataagtacacaaggtggatcatttagtatatttgaagatgagcta
ttttatggtatttctagttatgcaagagaaaagaaaattccacgtatatatatatcatgt
aattctggcgctcgtataggattatataattttttaatggataaaataagaattgaatgg
aaagacgaacagaaaaaagaactaggttataaatatatatatataacacaagatgtaaaa
gaacaaatagataaagaagatattatatttttaactgaaattatagaaaataatgaaaaa
agatatattattgatgctattgttgggaatttaaaaaatccagtaggtgtagagaatctc
agaggaagtggattaatagcaggagaaacttcaaaagcgtatgaagaaatttttacatta
tcttatgttactggtcgcagtgttggtattggtgcttatttagttagacttggtaaaagg
acaattcaaaaaaaaggctcttcgcttttgcttacaggttttaatgcattgaataaaata
ttaggtgaaaatgtatatgtaagtaatgaacagttaggtggtgttaatattatgatgagg
aatggtatatctcaagttcaggttgaaagtgatcaagaaggtatggataaaattatacaa
tggttatcttatgttcccagaactagtaatgattattatgatttaatacaaaatatatat
aaagaaaataatagaaaatttctacaaaataataactttttaataacaaataagcaaaag
actatgaatacatataacaacctttttatacataacaataaaaatgtaagtaattctgtc
gatataaaggataacataaagaaccagatagatacaaatataaatacggaaactaatatt
aatgtgcaagatttaaatattattaaaaaaaatgggattaatacaaaatcaaaacaagat
gaaaatgtgtatgaaaagaaagataaagtagaagaaatatataaagatcaaaacacatat
agtacaaataatagcaagacctctaaaccaaatgataattctatgagttcatacaatttt
gaacttttacatataaatgatatggattacgatcatatagatgattctaatattatcgat
ttgatcaagggtactcaagaagaacagggtttcttagataaaaatacctattttgaatat
atgaatgaatggggaaaaggtattataactggtagaggaaaattaggttctatacctgtt
ggatttattgctgttaataaaaatttagttacgcaatctattccatgtgatccagcatta
aaaacaaaagctcaaaaattaatacaagctccatgtgttttttttcctgataattctttt
aaaacagcacaatcaattgaagattttaataaggagaatttgcctttatttatttttgca
aattggagaggattttcaggtggatctatggatatgttttatggtatcttaaaatttgga
tctatgattgtaaatcagctagttaattataaacaccctgtatttgtatatatacctata
tctgctgaattgagaggtggatcatgggtagttgtcgatgaaacattgaatagccaaatt
atagaaatgtatgccgatgtcaatagtaaagggggaatattagaaccaccaggaattgtt
gaagttaagtttagatatcctgatattcgaaaattaatgcacagtattgatactaccata
attgctttgaatgaaaaaatggctagatgtgaaaatgatgaagagaagaacaatataaag
aaagatatagaaattaaggaaaaagagttgttgccatattatttacaagtgtgtcataaa
tatgcagatttacatgacatgtctacatgtatgaaagcaaagggtgtaattcgaaaaatt
gtcccatggaataaggcacgttcgtttttttattatcgtctaatgaggagattattaatt
aacatattgagtcgaaagtatgacaacgctttaatcaaaaatgaagagatagaaaatatt
ttaaatgaccttaataattcagaagatgatgattatattgtatgcaatagagttttcaat
aataatattttacgaaatttaaaatacgataccaaggatataatatataacaaaacatta
aatgactttttaaaaatttttaaaatgctatcacaggaacaaaggacagaatttctaaat
aaaataaattcttatgaaaattaa

DBGET integrated database retrieval system