KEGG   Plasmodium falciparum 3D7: PF14_0694Help
Entry
PF14_0694         CDS       T00095                                 

Gene name
PDI-14
Definition
protein disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PF14_0694 (PDI-14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
14:complement(join(2962923..2963006,2963118..2963224,2963352..2963679,2963881..2965023))
Genome map
AA seq 553 aa AA seqDB search
MHIDKLLIVFIFLIKLCVCHTEKGVKKEIVSINIDEFNNILKDEGNYTLLIVYTHWSYNS
NLLLENLDKLSKLLLYEENIKLCKINAAANTFIIDKLDVYSYPSLFMIRNKEIYRYNGVN
NIRGLLLWIYQYLDFKIYEINNIERLDVFIDLNEYNNTILFFIFKDLGTANNNINNISRI
NDLINICLLTNKTLCYYIKENNVIDYFEKNIIQDKYHYNLKNINQDSYYAILFKNDEFDD
YFFPLNKKELDMLSNNEYTNEEKIDHLYNWINEREQPLVIQFSEHFFSMLFSNDAVTLFI
IYNNINNINKDDIIKCAKKYNHKIKFAISGTTQIFEKRLLNELLIEDNIKKPLMRITEFK
NYIRFPYKYKPQSDDQEINEKTIDDFINGYLQEKKYFYRKSERALPDEYNNGYIKIIVAD
NYDQYVYKNDMNVIVLYYAPWCGHCYKFEPVYREVGKRLNLYAAKFKNYKNDIIISKIDA
VNNEIYNIHIEGYPTIYLYKKGDKLNPVRYMEGRTVKNIITWICKETQSNIDISEFLNID
LDNEQLFENYEEL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgataagttgctgattgtttttatttttttaataaagttatgtgtgtgccat
acagaaaaaggagttaagaaggaaatcgtttctataaatattgatgaatttaataatatt
ttaaaagacgaaggaaactatacacttttaatagtgtacacacactggtcatacaattca
aatttattattagaaaacctagacaaactatccaaacttttattgtatgaagagaatata
aagttatgtaaaataaatgcagcagcaaatacatttattatagataagttagatgtgtat
agttatccatctttatttatgattcgaaataaagaaatatatagatataatggtgtgaat
aatattagaggattattattatggatatatcaatacttagattttaaaatatatgaaatt
aataatatagagagattagatgtttttatagatttgaatgaatataataataccatttta
ttttttatatttaaagatttaggaacagcaaataataatataaataatatatcaagaata
aatgatttaataaatatatgtcttctaactaataaaacactttgttattatataaaagaa
aataatgttatagattatttcgaaaaaaatataatacaggataaatatcattataattta
aaaaacataaatcaagattcatattatgcaatattatttaaaaatgatgaatttgatgat
tatttcttccctcttaataaaaaagaattagatatgttaagtaataatgagtatacaaac
gaggaaaaaatagatcatttatataattggataaacgaaagagaacaaccattagttata
caattttctgaacatttcttttctatgctattttcaaatgacgctgttacactttttatt
atttataataatataaataatattaataaagacgatataataaaatgcgcgaagaaatat
aatcataagataaaatttgcaatatctggtacgacacaaatttttgaaaagcgattactc
aatgagttgcttatagaggataatattaaaaaaccccttatgaggataacagagtttaaa
aattatataagatttccttataaatataagccacaaagtgatgaccaggaaataaacgaa
aagacaattgatgattttattaatgggtatttacaagaaaaaaaatacttttatagaaaa
agtgaacgagccttaccagatgaatataacaacggatatataaaaattattgtcgcggat
aattatgatcaatatgtttataaaaatgacatgaatgttattgtattgtattacgctcct
tggtgtggacactgttataaattcgaacctgtttatagagaagtaggaaaaagattaaat
ttgtatgcagccaagttcaaaaattataaaaatgatattattataagtaaaattgatgcc
gtaaataatgaaatatataacatacatatagagggatatcctactatatatctatataaa
aagggggacaaattaaatcctgtaagatatatggagggaaggaccgtcaaaaatattatc
acgtggatttgcaaagagacccaatcaaatatagacatatcagaatttcttaatatcgat
cttgacaatgaacaactatttgaaaattatgaagaattataa

DBGET integrated database retrieval system