KEGG   Plasmodium falciparum 3D7: PFA_0480wHelp
Entry
PFA_0480w         CDS       T00095                                 

Definition
phenylalanyl-tRNA synthetase beta chain, putative (EC:6.1.1.20)
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:pfa00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
1:381851..383578
Genome map
AA seq 575 aa AA seqDB search
MSTNNVEEKKNEELYNLLNILEEEFNLSKIENKNNNKNDDGDDDDVNKREDNNNNEYYKK
LKDEKGLDVLINEYTTSLKISKKYNIDHNKVMGMIKKLETLYYIINLIKSFNTYHLSDEG
KQYLKEGSPEFIVIKYVIQNNKCTLEDLKKNLGKIGDIGLNTNLKNRTIQLNKADKCLTC
NCNLHDIQDFTQIYLDIINQYGHDEELLFAHLKNKNHTKNALNNNEMKNSCKDNNIINNL
IQDLKKRKLLEIKKNSYSHVIKTSIFKKDIKKQITDINYLLLKNEEYKKYDIKKYNFFSS
GKKINKGNIHLLTKQMRTFKEIFFSLGFEEMETHNYVESSFWCFDALYIPQQHPSRDLQD
TFFIKEPETCIDKFVDTEYIDNIKRVHTHGDYGSFGWNYKWKLEESKKNVLRTHTTANSC
RALFKLAKEYKEAGCIKPKKYFSIDRVFRNENLDSTHLAEFHQVEGLIIDKNIGLSHLIG
TLAAFYKHIGIHKLKFKPTFNPYTEPSMEIYGYHEQSKKWLEVGNSGIFRPEMLRSMGFS
EEVSVIAWGLSLERPTMIKYNIKNIRDLFGYKSVV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgaataatgtggaagagaaaaaaaatgaggaattatataatttgctgaacata
cttgaagaagaatttaatttgagtaagatagaaaataaaaataataataagaatgatgat
ggtgatgatgatgatgttaataaaagagaagataataataataatgaatattacaaaaaa
ttaaaagatgagaaaggtttagatgtacttataaatgaatatacaacatccttaaagata
agtaagaaatataatattgatcataataaagtaatgggtatgattaaaaaacttgaaaca
ttatattatattattaatcttattaaatcttttaatacatatcatttgagtgacgaaggt
aaacaatatttaaaagaaggttctcctgaatttattgttataaaatatgtaattcaaaat
aataaatgtacattagaagatttaaaaaaaaaccttggaaaaataggagatataggtcta
aatacaaatttaaaaaatcgtacgatacaattaaataaagctgataaatgtttaacatgt
aattgtaatttacatgatatacaagactttactcaaatatatttggatataataaatcaa
tatggtcatgatgaagaactattatttgcccatttaaaaaataaaaatcatacgaagaac
gcattaaataataatgaaatgaaaaattcttgtaaagataataatattattaacaattta
atacaagatttaaaaaaaaggaaattattagaaataaaaaaaaattcatatagtcatgta
attaaaacgagcatttttaaaaaagatattaaaaaacaaattacagatataaattatcta
ttattaaaaaatgaagaatataaaaaatatgatataaaaaaatataattttttttcgagt
gggaagaaaatcaacaagggaaatattcatcttttaacaaaacaaatgagaacatttaaa
gaaatatttttttctttaggatttgaagaaatggaaactcataattatgtagaatcatct
ttttggtgtttcgatgctttatatattccacaacaacatccaagtagagatttacaagat
accttttttataaaagaaccagaaacttgtatagataaatttgtagatacagaatatatc
gataatattaaaagagtacatacacatggtgattatggaagttttggatggaattataaa
tggaaactagaagaaagtaaaaaaaatgttttaagaactcatactacagcaaattcttgt
agagctttatttaaactagccaaagaatataaagaagcaggatgtataaaacccaaaaaa
tattttagtatcgatcgtgtttttagaaatgaaaatttagatagtacacatttagctgaa
tttcatcaagtagaaggacttattatcgataaaaatattggactttctcatttaataggt
acattagcagcattttataaacacataggtattcacaagctaaaatttaaaccgaccttt
aatccatatactgaaccatccatggaaatatatggatatcacgagcagagtaaaaagtgg
ctagaagttggaaatagtggcatctttagaccagaaatgttaagatccatgggattctcc
gaagaagtatccgtaatagcctggggactaagtctggagagaccaacaatgattaaatat
aacataaaaaatattagggacctttttggatacaaaagtgttgtatga

DBGET integrated database retrieval system