KEGG   Plasmodium falciparum 3D7: PFA_0570wHelp
Entry
PFA_0570w         CDS       T00095                                 

Definition
conserved Plasmodium protein, unknown function
Orthology
K03259  
translation initiation factor 4E
Organism
pfa  Plasmodium falciparum 3D7
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PFA_0570w
Translation factors [BR:pfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PFA_0570w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
1:join(447177..447926,448043..448167,448269..448356,448490..448573,448768..448898,448992..449013,449178..449340,449542..449970,450252..450433)
Genome map
AA seq 657 aa AA seqDB search
MEGNDKCLNVTLADIEKDTMKNNLSLNSKGNELLNNKKSGYKNNIKKKKKKSIKENNGNE
QNKGNGTLTLKNEENDSKVFKTYRNKRNSKNDNMEKHKNDVTKNENDITKNENDEIIKED
KNSNLGKTNGYNIKDIRRKKKDNNKEYIRDHMKKKKDIIMNNKGKKNNSNNNNNDNNDNN
DNNNSNNSNNNNNNNNNNSNEYTKRKNTHKKHLNEHYKNESNKKKVNEKKYNNSVYVNNN
IKKNHVNKNKNENYLQNVWLFLFDNEVRKENDQCVGKIISLDTFNTIEKFYKNYKYMKSP
SAIKEKYNIYLFKQNFRPLFDEYPNGFICTVKNANHFKNDSVDIIWEKMVLLAIGEEFSL
IDLCGLQLCIRDNEMFFKIWMKNYSNYLKNILMKKLRDAYNVYNNKKNQQGKGKNEKAKK
NYNKNNKGAEFVASKKDSLKMHNYPNIVPPPNYLGNYNVYKYNLDMNLFYLYNNQNMPNP
YIYIPVNVPNNQYNNIYPDYMYDSNTSYPIDIINNNLLSNDINVPSNFVNNKMNGSIIVD
KKSKIDYGLKNEDYKKKSMNSLNSNDIYEDSKSTTCIKSVYTDDEYEYNNSSNNNNNISY
ACPGDHDKTFCELRKNPNESSILVIINLKEFYTEVRLAYELYIIYNRRMKKKNNKTN
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaatgataagtgtttaaatgtcaccttggctgacatagaaaaagatacaatg
aaaaataatttaagcctaaatagtaaaggtaatgaacttttaaataataagaaaagtggt
tataaaaataatataaagaaaaaaaagaaaaaaagtataaaggaaaataatgggaatgaa
caaaataaaggtaatggtactcttaccctaaagaatgaagaaaatgatagtaaggtattc
aaaacatacagaaataaaagaaatagcaaaaatgataatatggaaaaacataaaaatgat
gtaacaaaaaatgaaaatgatataacaaaaaatgaaaatgatgagataataaaagaagat
aaaaatagcaatttaggaaaaaccaatggatataatataaaagatataagaagaaaaaaa
aaagacaataataaagaatacataagagaccatatgaaaaaaaaaaaagatataataatg
aataataaaggaaaaaaaaataatagtaataataataataatgacaataatgataataat
gataataataatagtaataatagcaataataataataataataataataataatagtaat
gaatatacaaaaagaaagaatacacataaaaaacatttaaatgaacactataaaaatgag
agtaataagaaaaaggttaatgaaaagaaatacaataatagtgtgtatgttaataataat
ataaagaaaaatcatgtcaacaaaaataaaaatgaaaattatttacaaaatgtgtggtta
tttttattcgataatgaagttagaaaagaaaatgaccaatgtgttggaaaaattatatca
ctggatactttcaataccatagaaaaattttacaagaactataaatatatgaaatcgcct
tcagccattaaggaaaaatacaacatttatctttttaaacaaaattttagacccctcttt
gacgaatatccaaatggttttatttgtaccgttaaaaatgccaatcattttaaaaatgac
agcgttgatataatatgggaaaaaatggttcttttggctataggagaagaatttagctta
atcgacttatgtggtttacaattatgcataagagataatgaaatgttttttaaaatatgg
atgaaaaattattcaaattatctaaaaaatatattgatgaaaaaattaagggacgcctac
aatgtatacaataacaaaaaaaatcaacaaggaaagggaaaaaatgaaaaggctaaaaag
aattacaataaaaataataagggcgcagaatttgtagctagtaaaaaggattctttaaaa
atgcataattatccaaacatagtaccaccaccaaattatttaggaaattacaatgtttac
aaatacaacctagatatgaatttgttttatttatataataatcaaaatatgcctaacccg
tatatatacattcctgtcaatgtacccaataatcaatataataatatttatccagattat
atgtacgacagtaatacgagctatcctatagatataattaataataatttattaagtaat
gatattaatgtaccaagcaattttgtaaataataaaatgaatggatcgataatagtagat
aaaaaaagtaaaattgattatggattaaagaatgaggattataaaaaaaaatctatgaat
tccttaaattcgaatgatatatatgaagatagtaaaagtactacatgtattaaatccgta
tataccgatgatgaatatgaatataataatagtagtaataataataataatatatcgtat
gcttgtcctggtgatcatgataaaacgttttgtgaattacgaaagaacccaaatgaatct
tccatccttgtaattataaatttaaaagaattttatacggaggtaagattagcatatgaa
ctatatattatatataataggagaatgaaaaaaaaaaacaataaaacaaattaa

DBGET integrated database retrieval system