KEGG   Plasmodium falciparum 3D7: PFC0395wHelp
Entry
PFC0395w          CDS       T00095                                 

Definition
asparagine synthetase, putative (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pfa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
3:join(399607..399686,400362..402114)
Genome map
AA seq 610 aa AA seqDB search
MCGILAIFHSSIEKHRLRRKALNLSKILRHRGPDWNGIVVEENDDGTTNVLAHERLAIVD
VLSGHQPLYDDEEEVCLTINGEIYNHLELRKLIKEENLNKLKSCSDCAVIPNLFKIYKEK
IPSMLDGIFAGVISDKKNNTFFAFRDPIGICPLYIGYAADGSIWFSSEFKALKDNCIRYV
IFPPGHYYKNNKNKGEFVRYYNPNWWSLNNSIPNNKVDFNEIRIHLEKAVIKRLMGDVPF
GILLSGGLDSSIIAAILAKHLNILDNKNGKSIQNGNDKKSNNNGNESNNNNNNNNFNNNN
SGPQKLRSFSIGLKGSPDLKAAKEVAEYLGIEHTEFYFTVEEGIDSLHDVIYHIETYDIT
TIRASTPMYILSRLIKSSCVKMVLSGEGSDEIFGGYLYFHKAPNKEEFHRELQRKIHDLH
YYDVLRANKSTMAFGIEARVPFLDIQFLNVVMNIDPQDKMCSNNKIEKYILRKAFEGYLP
EHILYRQKEQFSDGVGYNWIDGLKQYAEKKISDIQFSRAKFLFPYNTPKTKEGYLYRCIF
SECFPEQCAQESVPQGESIACSTSKAVEWDESFKQNADQSGRSVLGIHRHSKQFDDVKCI
PLQNQESINY
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatactagccatttttcattcatctatagaaaaacatcgattaagaaggaag
gccctaaatttatcaaaaatactgagacataggggacccgactggaacggcatcgtagtt
gaggagaatgatgatgggacgacaaatgtgctggcacatgaacgtctagctatagtagac
gtattatctggtcaccaacccttatatgatgatgaagaagaggtatgtttaacaataaat
ggagaaatatataatcatttggaattaagaaaattaataaaagaagagaatttgaataaa
ttaaaaagttgttctgattgtgcagtgataccaaatttatttaaaatatataaagagaaa
attccatccatgttagatggtatatttgcgggtgtaattagtgacaagaaaaataataca
ttttttgcttttcgagatcctataggtatatgtccattatatataggttatgcagctgat
ggctctatatggttttcatctgaatttaaagccttaaaagataattgtataagatatgta
atatttccccctggtcattattataagaataataaaaataaaggagaatttgttaggtac
tataaccctaattggtggtctttaaataatagcataccaaataataaagtcgattttaat
gaaatacgtatacatttagaaaaggcagtaataaaaagattaatgggtgatgtgcctttt
ggtatcttattatcaggaggattagattcatccataattgctgcaatccttgctaagcat
ttaaatattttagataacaaaaatgggaaaagcattcaaaatggtaatgataaaaagagt
aacaacaatggaaatgagagcaacaataataataataataataattttaataataacaac
tcaggacctcaaaaactgagaagcttttctataggtttaaaaggctctcctgatttaaaa
gcagcaaaagaggtagctgaatatttaggtatagaacataccgaattttattttactgtt
gaagaaggtatagattcattacatgatgtaatttatcatatagaaacgtatgatattacc
actatacgtgcatctacacctatgtatattttatcaagattaattaaaagtagttgtgtt
aaaatggttttaagtggggaaggttcggatgaaatatttggagggtatctatattttcat
aaagcacctaataaagaagaatttcatagagaacttcaaagaaaaatacatgatctacat
tattatgatgtactaagagccaataaatctactatggcctttggtattgaagcaagggta
ccctttttagatatacaattcttgaatgttgttatgaatattgacccacaagataaaatg
tgctcaaataataaaatagaaaaatatattttaagaaaagcatttgaaggatatttacct
gaacatatcctatacagacaaaaagaacaattctcagatggtgttggatataattggatt
gatggattaaaacaatatgcagaaaaaaaaatatcagatattcaattttcaagagcaaaa
tttcttttcccatataatacacccaaaaccaaagaaggatatctatacagatgtattttc
tcagagtgcttccctgaacaatgtgcacaagaatcagtaccacaaggagaatccatcgca
tgctcaactagtaaagccgttgaatgggatgaaagttttaaacaaaatgctgaccagtca
ggtcgatcggttctaggaatacatagacactcgaagcaatttgatgatgtaaaatgtatt
ccgttacaaaatcaagaaagcatcaattattaa

DBGET integrated database retrieval system