KEGG   Plasmodium falciparum 3D7: PFC0635cHelp
Entry
PFC0635c          CDS       T00095                                 

Definition
(RefSeq) translation initiation factor E4, putative
  KO
K03259  
translation initiation factor 4E
Organism
pfa  Plasmodium falciparum 3D7
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PFC0635c
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PFC0635c
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PFC0635c
Translation factors [BR:pfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PFC0635c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
3:complement(609414..610097)
Genome map
AA seq 227 aa AA seqDB search
MKYLTFNKNNRDAIDLSEKLEATKIDLSNPLLLQYNWVIWEQVSDNKIKQSNNYKDYTRP
LAKFNSVQKFWQLWNRLPQPSDLLAQRSMTRFSEDGIFRIVDALMIFRDNIQPMWEDPAN
SGGGHFEYKILPKDYPYSQIDEFWNNLVLAIIGCSLKHYDLITGIRLVDKLSTTRYGYIR
IEIWYTTITDESVKNYLRKDLEEHMCNRIDGSTIFPPRVKSLSHIHR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttaacatttaataaaaataacagagatgctattgatttgagtgaaaaacta
gaagctactaaaatagatttatcgaatcccttattattacaatataattgggtgatatgg
gaacaagtatcagataataaaataaaacaaagtaataattataaggattatacaagacca
ctagctaaatttaatagtgttcaaaaattttggcaattatggaatagattacctcaacca
agtgatttactggcacaaagaagtatgaccagattttcagaagatggaatatttcgtatt
gttgatgctcttatgatatttagagataatatacaacctatgtgggaagatccagcaaat
tcaggcggtggtcattttgaatataaaatattacctaaggattatccatatagccaaatt
gatgaattttggaataatctcgttttagctataattggatgtagtttaaaacattatgat
ttaataacaggtattagattagtagataaattaagtactacaagatatggatatataaga
atagaaatatggtatactactataactgatgaaagtgttaaaaactatttgagaaaagat
ctagaagaacatatgtgtaatcgtattgatggatcgactatatttccaccaagagtaaaa
agtcttagtcacatacatagataa

DBGET integrated database retrieval system