KEGG   Plasmodium falciparum 3D7: PFC0831wHelp
Entry
PFC0831w          CDS       T00095                                 

Definition
(RefSeq) triosephophate isomerase, putative
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFC0831w
   01230 Biosynthesis of amino acids
    PFC0831w
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFC0831w
   00051 Fructose and mannose metabolism
    PFC0831w
   00562 Inositol phosphate metabolism
    PFC0831w
Enzymes [BR:pfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PFC0831w
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PFC0831w
  Exosomal proteins of bladder cancer cells
   PFC0831w
  Exosomal proteins of melanoma cells
   PFC0831w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
3:join(786529..787290,787399..787519,787687..787781,787884..787979)
Genome map
AA seq 357 aa AA seqDB search
MLKTLVLLSFYSLYTVFQKSTNCLTIYSSFRKKGKECYVLISSTYILKNKSKKLSRDTCR
ILKKFERNNSSDKKFIKTYCIENKNDYMENILTHDEQKKKKKKKKILIANWKCYLSKEEA
YKLIDSLTRIKYSNYVDVILSLNLLYIPYLLQKIKENNSKIYACSQDVSLVNGFGPFTGE
TTAKLIQDFGNEYTLIGHSERRQGFYKNGETIEEIVLKVYNAINSKLKVILCTGDDYKNC
DNPSSSYKMMELLRLIKTKISKDEMKNIIIAFEPRFAIGTGQPVSYDILNKYYYELKRDI
AKEIDKSTSEEMMIVYGGSISKSNMKHYVDNTHVDGFLIGKASLNEDFIDIIRYVDH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacacttgtgttattatctttttattctctatataccgtattccaaaaatca
accaactgtctaactatatattcttccttccgaaaaaaaggaaaggaatgttatgtatta
atttcttctacttatatattaaaaaataaaagtaaaaaactttcaagagatacatgcaga
atcctgaaaaaattcgaacggaataattcgagtgataaaaaatttataaaaacatattgc
atagaaaataaaaatgattatatggaaaatatattaacccatgatgaacaaaaaaaaaaa
aaaaaaaaaaaaaaaattttaatagctaactggaaatgctatttatcaaaagaggaagca
tataaattaattgatagtttgacaagaattaaatattctaattatgtcgatgtaatatta
tctcttaatttattatatataccatatcttttacaaaagataaaagaaaataattctaag
atatatgcgtgttctcaagatgtaagtttagttaatggtttcggaccatttacaggagaa
acaactgcaaaattaattcaggactttggtaatgaatatactttaataggacatagtgaa
agaagacaaggtttttataaaaatggagaaactattgaagagatagttttgaaggtatat
aatgcaattaattctaaattaaaagtaatactatgtactggtgatgattataaaaattgt
gataatccttcatcttcatacaaaatgatggagctcttacgacttatcaaaactaaaatt
tcaaaagatgaaatgaaaaatataatcatagcctttgagccaaggtttgctataggtaca
ggacaacctgtatcttatgatatattaaataaatattattatgaattaaaaagggacata
gcaaaagaaatcgacaagtcaacaagtgaagaaatgatgatagtttacggaggatctata
tccaagtctaatatgaaacattatgtagataatactcatgtggatggcttcttaattgga
aaggcttcattaaatgaagactttatcgatattataagatatgtagatcattag

DBGET integrated database retrieval system