KEGG   Plasmodium falciparum 3D7: PFC0831wHelp
Entry
PFC0831w          CDS       T00095                                 

Definition
triosephophate isomerase, putative (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pfa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfa00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pfa00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pfa00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
3:join(786529..787290,787399..787519,787687..787781,787884..787979)
Genome map
AA seq 357 aa AA seqDB search
MLKTLVLLSFYSLYTVFQKSTNCLTIYSSFRKKGKECYVLISSTYILKNKSKKLSRDTCR
ILKKFERNNSSDKKFIKTYCIENKNDYMENILTHDEQKKKKKKKKILIANWKCYLSKEEA
YKLIDSLTRIKYSNYVDVILSLNLLYIPYLLQKIKENNSKIYACSQDVSLVNGFGPFTGE
TTAKLIQDFGNEYTLIGHSERRQGFYKNGETIEEIVLKVYNAINSKLKVILCTGDDYKNC
DNPSSSYKMMELLRLIKTKISKDEMKNIIIAFEPRFAIGTGQPVSYDILNKYYYELKRDI
AKEIDKSTSEEMMIVYGGSISKSNMKHYVDNTHVDGFLIGKASLNEDFIDIIRYVDH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacacttgtgttattatctttttattctctatataccgtattccaaaaatca
accaactgtctaactatatattcttccttccgaaaaaaaggaaaggaatgttatgtatta
atttcttctacttatatattaaaaaataaaagtaaaaaactttcaagagatacatgcaga
atcctgaaaaaattcgaacggaataattcgagtgataaaaaatttataaaaacatattgc
atagaaaataaaaatgattatatggaaaatatattaacccatgatgaacaaaaaaaaaaa
aaaaaaaaaaaaaaaattttaatagctaactggaaatgctatttatcaaaagaggaagca
tataaattaattgatagtttgacaagaattaaatattctaattatgtcgatgtaatatta
tctcttaatttattatatataccatatcttttacaaaagataaaagaaaataattctaag
atatatgcgtgttctcaagatgtaagtttagttaatggtttcggaccatttacaggagaa
acaactgcaaaattaattcaggactttggtaatgaatatactttaataggacatagtgaa
agaagacaaggtttttataaaaatggagaaactattgaagagatagttttgaaggtatat
aatgcaattaattctaaattaaaagtaatactatgtactggtgatgattataaaaattgt
gataatccttcatcttcatacaaaatgatggagctcttacgacttatcaaaactaaaatt
tcaaaagatgaaatgaaaaatataatcatagcctttgagccaaggtttgctataggtaca
ggacaacctgtatcttatgatatattaaataaatattattatgaattaaaaagggacata
gcaaaagaaatcgacaagtcaacaagtgaagaaatgatgatagtttacggaggatctata
tccaagtctaatatgaaacattatgtagataatactcatgtggatggcttcttaattgga
aaggcttcattaaatgaagactttatcgatattataagatatgtagatcattag

DBGET integrated database retrieval system