KEGG   Plasmodium falciparum 3D7: PFD0165wHelp
Entry
PFD0165w          CDS       T00095                                 

Definition
ubiquitin specific protease, putative (EC:3.1.2.15)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFD0165w
Peptidases [BR:pfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PFD0165w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
4:202002..203204
Genome map
AA seq 400 aa AA seqDB search
MNITENNLLELLSLKNYDYYLKYYNYEHVERKHISFNNSGNICYCNASLQLILSIKPLCI
YLLKKLKKISFNTKSKYKGDILKTVCDLIEEVYGKTNSDSNNNNNNSNSNNKNKSYIICT
NKHINLLKKIKKYNNNIIINAQNDAHEFLLMLLNFINVECNRYLKIPENFDIKLNDKDNK
QNAGDKYWIKYLFKDNSIVTDLLGFQNISSITCINCGHTRYSFEFCIDLGLEFHEENMKS
TNLIDLLKNNIIQEEHFCYLDCENCKLKKTSRVKKGIYRLPNLYMIIYIKRFKWIYDQRT
NYYNNKIKKIDTTVLLPLDGIIDFTSFSHMSTHKSLINSKYIIESIICHTGNCYNGHYTC
IVKYSDGFYKCNDEKIRKINNPYSSENINDIYLLLLRRLP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaccgaaaataaccttctcgagctcctatcattaaaaaattatgattattat
ttaaaatattataactatgaacatgttgaaagaaaacacatttcgtttaataacagcggg
aacatatgttactgtaacgcttctttacaattaatattatctataaaacctttgtgtatt
tatttattgaaaaaattaaaaaaaatatcttttaatacaaaatctaaatataaaggagat
atattaaaaactgtttgtgatttaatagaagaagtatatgggaaaaccaactcagatagt
aataataataataataatagtaatagtaataataaaaataaaagttatataatttgtaca
aataaacatataaatttattaaaaaaaattaaaaaatataataataatattataattaat
gctcaaaatgatgcacatgaatttttattgatgttattaaattttataaatgtggaatgt
aatagatatttaaagataccagaaaacttcgatataaaattaaatgataaagataataaa
caaaatgctggagataagtattggataaaatatttatttaaagataacagtattgtgacc
gacttattaggctttcaaaatatttcaagtattacatgtattaattgtggacataccaga
tatagttttgaattctgtattgacttaggtttagagtttcacgaagaaaatatgaaaagt
acaaatcttatagacctattaaaaaataatattatacaagaagaacatttctgttattta
gattgtgaaaattgtaaattaaaaaaaacaagtcgagttaaaaaaggaatatatagattg
ccaaacttgtatatgattatttatattaaaagatttaaatggatatatgatcaacgtaca
aattattataataataaaatcaaaaaaattgatactactgttttgttaccattagatggt
attattgattttacatccttttcacatatgtcaactcataaatcattaattaattcaaaa
tatattatagaaagtattatatgtcatacaggaaattgttataatggtcattatacttgt
attgttaaatatagtgatggattttataaatgtaacgatgaaaaaattaggaaaataaac
aatccatacagctcagaaaatattaacgacatatatttgttgctactcaggcgattaccc
taa

DBGET integrated database retrieval system