KEGG   Plasmodium falciparum 3D7: PFD0680cHelp
Entry
PFD0680c          CDS       T00095                                 

Definition
ubiquitin carboxyl-terminal hydrolase A, putative (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PFD0680c
Peptidases [BR:pfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PFD0680c
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PFD0680c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
4:complement(join(630151..630244,630393..630480,630663..632944,633112..633209))
Genome map
AA seq 853 aa AA seqDB search
MADIKSIISLISTIVKDEPTKEEVIYLGECSITGHKDFFEDGIFIDLLSFESFSLKFLKC
NYNRLSKLSSEGKNHRFYLNIKKKKNLLENIEKKVITNLNINAEGGFNENKVYEYEWEYS
VYDIETGLYIKLEDLDESVQKICKGIINHKNEVKKDNINKWVNDIKESKYAKDLVQLEGI
KIKNENIHCAVCKSTKNIWLNLSDGYIGCGRKIFNYGGGCLNNEEGAALKHFYESGKKYP
LVVKIGTITKDGEADVFSYADDENDSVIDPYIGVHLKNLGINIMNLEKTEITTLEKEIEE
NQNINFSSILDNNIQTICQQGKIGFVNLGNTCYMNSALQVLLSIKDISYRYLNNISDFLL
SLDYKKKTHDDLFLQYSKLCYMIFEEDYITKKKQYVKKFKTQCKDRNVEINYDSDIDDEN
SVSINPSMFRNCINQKSNSFCNNNQQDIYEYLSYLINELIDNENNIFDRILKVNNNKRKL
NEINNETNEKLNPNELLNSTSPSNNDSNVTKERSLFNYFTFEIEQRIESESNNQSISSFQ
NNILSLDIPLDSSLLNGDEEKLKNVNISLLDCLNNYIKKDNIDEYYCQKEKKKIHAQKYM
KFKTFPPYLFIHLKRFYADENWSAKKINIEVKTDEQLNLEFMRVQPNSTDVLNGQKEQET
SPGDSMLQKESKLLEDHKDVLDSLLDFGFEKDKAIEAIKKVKIKNVNNCISYIYGEDTVE
LDDDVNCEKEEVNSNNLDSIINLGVKKEVAMAALILNKNNLQKAIDYIFSNLDDLTDSKC
NLIINSNKCNDGLANYELVASIVHIGNNANSGHYICYIKDESKWYICNDNKIGLCEGNLG
KDSAYIHLYKRLS
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atggctgatattaaaagtataatatctttaatttctacaattgtaaaagatgagcctacc
aaagaagaagtaatatatttaggagaatgtagtataacagggcataaagatttttttgaa
gatggtatattcatcgatttgttgtccttcgaaagtttcagtttgaaattcttaaaatgc
aattataaccgattaagtaagttatcaagtgaaggaaaaaatcaccgattttacctgaat
ataaaaaagaagaaaaatttgctagagaatatagaaaaaaaagttataacgaatttgaat
attaatgcggaaggtggttttaatgaaaacaaagtttatgaatatgaatgggaatattct
gtatatgatatagaaacaggtttgtatataaaattagaagatttggatgaatctgttcag
aaaatatgtaaaggtataattaaccataaaaatgaagtgaagaaagataatataaacaaa
tgggtaaatgatataaaagaaagtaagtatgcaaaagatttagttcagcttgaaggaata
aaaataaaaaatgaaaatatacattgtgcagtttgtaaatctacgaaaaatatatggtta
aatttatctgatggatatattggttgtggacgaaaaatttttaattatggaggaggatgt
ttaaataatgaagaaggagcagctttaaaacatttttacgaaagtgggaagaaatatcct
ttagtagttaaaataggaactattacaaaagatggagaagcagatgtgttttcttatgca
gatgatgaaaatgatagtgtaatcgatccatatataggtgtgcatttaaaaaatttaggt
ataaatattatgaatttagaaaaaacagaaataacaactttagaaaaagaaatcgaagaa
aatcaaaatattaatttttcatcaattcttgataataatatacaaacaatatgccaacaa
ggtaaaatcggttttgtcaatttaggaaacacatgttatatgaacagtgcattacaagtt
ttgttatctattaaagatattagttatagatatttaaataatatttctgatttcttatta
agtttagattataaaaaaaaaacgcatgatgatttatttttacaatattcaaagttatgc
tatatgatatttgaagaagattatattactaaaaaaaaacaatatgtcaaaaaattcaaa
acacaatgtaaggacagaaatgtagaaattaattacgatagtgatattgatgatgaaaat
tcggttagtattaatccatccatgtttagaaattgtattaaccaaaagagtaattcattc
tgtaataataatcaacaagatatttatgaatatttatcatacctaattaatgagttgata
gataatgaaaataacatattcgatcgaatattaaaagttaacaataataaaagaaagttg
aatgaaattaataatgaaacaaatgaaaaactaaacccaaatgaattgctcaattcaact
tcaccatcaaataatgattctaatgtaacaaaagaaagatcactttttaattatttcaca
tttgaaattgaacaaagaatagaaagcgaatcaaataaccaaagtattagttcatttcaa
aataatatattatcattagatatacctttggatagttcattattaaatggagatgaagaa
aaattaaaaaatgttaatatatccttattagattgtttaaataattatattaaaaaggat
aacatagatgaatattattgtcaaaaagaaaaaaaaaaaatacatgcacaaaaatatatg
aaatttaaaacattcccaccttatctttttatccatcttaagcgtttttatgcagatgaa
aactggtcagcaaaaaaaattaatattgaagttaaaacagatgaacaattaaatttggaa
tttatgagggttcaaccaaattccactgatgttctaaatggacaaaaggaacaagaaacg
agtccaggtgactcaatgttacaaaaagaaagtaaacttttagaagatcataaagatgtt
ttagattctttgttagactttggttttgaaaaggataaggcaatagaggcaattaaaaag
gtaaaaataaaaaatgtaaataattgtatatcttatatttatggagaagatacagtagag
ttggatgatgacgtgaattgtgaaaaagaagaagtaaattctaataatttggattctata
attaatttgggagtaaaaaaagaagtggctatggcagcacttatactgaataaaaataat
ttacaaaaagcaattgattatatattttcgaatttggatgatttaacggatagtaagtgt
aatttgattataaatagtaacaagtgtaacgatggattggctaattatgaattagtagca
tctattgtacatataggaaacaatgccaattcgggtcattatatatgttatataaaggat
gaatccaaatggtatatttgcaacgataataaaattggcctatgtgaaggaaatttaggt
aaagacagtgcatacattcatttgtacaaaagactttcataa

DBGET integrated database retrieval system