KEGG   Plasmodium falciparum 3D7: PFD0795wHelp
Entry
PFD0795w          CDS       T00095                                 

Definition
conserved Plasmodium protein, unknown function
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pfa  Plasmodium falciparum 3D7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
4:join(725185..725472,725586..728987,729295..729347,729601..729637)
Genome map
AA seq 1259 aa AA seqDB search
MRTKNANKLNVEQTTGEIKKVELNREYYNCIKTYASDLQNLSFNFFPSINTYTCVPKLSA
VNTITFHPCISSSDYINKTYTFKPLFTHHFFSDSEQVIGFENLNIEFYYTCDNYEVFMKL
NGSICDQYENSNYIMLMLLQSLYITTPYPGGFIESEDKFLSILNRNDKKLVKKNSYEELV
RNAMYKPPGYIIYEKHISKDIILQIRKCGFSSEYFKFDSSSDIKNIKRETVNAENEQICD
ENSPNNAKASHENTSGSLVPTDVLEWDRTVNKRKAAVNNILIRSEKRGSRSRTNSIHTKS
ESRKSSIVRRNTSDSLSKSKEDIEDNTKKVVPGNGRRRRRKKSTVDNMENNVNDSNLNES
NTNENIGNKDNHEILDNNEIMNNNENVNNNNDNNKNNENIDDNNNNNNDNNNDNNNDNNN
DNDNDNVVSEKNKVGTRKYSDSKNSCSSINARNNALNVWTKGKRRRRKKKREALIKNDAD
GNNSGEENKVVKSLYTRNVTEKDMSQMYKDYLKVLDERKNQKKKKKRKRRRKKKNVEGGE
NEGKPKQTIEGGEASDKCSINDQKGGKEYNKEGEREKEEEEEEEDDDEYDEYDEDDVEEE
IDEEERLRKLISENYHNRYDYTVKDNFEILHRRVEWFYHWFIESASNIEYDYRWSVILPY
IIFKHDKSKPFAKNNFIDNLNAELFKSRSSPTTNVQKKDVKEETMNGCKVEGGSLEVANK
LSEKKNASTVTNISTVTNISNVSKVTSIKSKSNGSKNNQSDVQNDKELSEGTLNVHKKEK
QTDEVIVVEDEYEDGNEEKKKSTGKRCLLTNGQEVNENKKRNKGQGHEDERNDNNIEIVE
IKDDVEVIEISEGEEKEGKKRENTVNSNKSSSNSNSNNKKNNISSSGCNGSDNNNNNNVT
QTDVACFPKEYVITNDLVKQAIFDTLNNVNNKNEEDYYSFHNDHDVVYLYADLLKEKEDN
NRNNNNNNILDEQKEDKDKVNSIEKWKRESASKTNVIERFNSKKEEQNDESSEYCYYFYL
FGLATTYTFFTFQFDRNRISQFLIFPPMQCKGLGMQVLEKIYHLSIVNTNIREITVEDPA
VSFTQLRDIITIKMCIDLNILSPSVLYPQEYLTTKNIQKENVELDKRKFMTVCKETHKQI
TRMIETLMLADVLPHPAPAYTDNEEKVTGLRKREKKNDNSSCLNSMEYFESSDLCKQVRI
KIKKRIKNDYIGNLINKNMNCMASDVFQDYVKEELYKLWRKQCRVYYRTIRKLRNIYPL
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgaaaaatgcaaacaaattaaatgtagaacagaccacaggtgaaattaaaaaa
gttgaactaaatcgagaatattataattgtataaaaacatatgcaagtgatttacagaat
ttatcttttaatttttttccatccataaatacatacacatgtgtacctaaacttagtgct
gttaatacaataacatttcatccatgtatatcgagttctgattatattaataaaacatat
actttcaaaccattatttactcatcatttttttagtgacagtgaacaggtaattggattt
gaaaatttgaatatagaattttattatacgtgcgacaattatgaagtgttcatgaaattg
aatgggtccatatgtgaccaatatgaaaattcaaattatatcatgttaatgcttttacaa
agtttatatatcaccactccttatccaggtggctttatagaaagtgaagataaattttta
agtatattaaatcgaaatgataaaaaattagttaaaaagaatagttatgaggaactagtg
aggaatgcaatgtataagcctccggggtatattatttatgagaaacatattagtaaagat
ataattttacaaatacgcaaatgtggattttcttctgaatattttaaatttgatagtagt
agtgacataaaaaatataaaaagagaaactgtaaacgcagaaaatgaacagatatgtgat
gaaaatagtccaaataatgcaaaagctagtcatgaaaatacatcgggaagcttagtacct
actgatgttttggaatgggatagaactgtgaataaaaggaaagcagctgttaataatatt
ttgattagaagcgaaaagagaggttcaagaagtaggacgaatagtatacataccaaatca
gagtctagaaaaagtagtattgttaggagaaatacaagtgatagtcttagtaaaagtaaa
gaggatattgaggataatacaaagaaggtggttcctggtaatggtagacgaaggaggagg
aaaaaaagtacagttgataatatggaaaataatgtaaatgatagtaatttaaatgaaagc
aatacaaatgaaaatataggtaataaagacaaccacgaaattttggataacaatgaaatt
atgaataataatgaaaatgtgaataataataatgataataataagaataatgaaaatata
gatgataataataataacaataatgataacaataatgataacaataatgataacaataat
gataatgataatgataatgtcgtttctgaaaagaataaggtgggtacgagaaaatattca
gattccaaaaactcctgcagcagtattaatgctcgtaacaatgccctaaacgtatggacc
aaaggaaaaagaagaagacgtaaaaagaaaagagaagcattaattaaaaatgatgctgat
ggcaataattcaggggaagaaaataaagttgtaaaaagtttgtatacaagaaatgttaca
gaaaaggatatgtctcaaatgtacaaagattatttaaaagtattagatgaacgaaaaaat
caaaagaagaagaaaaaaagaaaaagacgaagaaaaaaaaaaaatgtagaaggaggagaa
aacgaaggaaaacctaaacagactatagaaggaggagaagcttcagataaatgttctatt
aatgatcagaaaggaggaaaagaatacaacaaagaaggagaaagagaaaaagaagaagaa
gaagaagaagaagatgatgatgagtatgatgagtatgatgaggatgatgtagaagaagaa
attgatgaagaagaaaggttaagaaaattgataagtgaaaattatcataatagatatgat
tataccgttaaagataattttgaaattttacatagaagagttgaatggttttatcattgg
tttattgaaagtgcatcaaacattgaatatgattatagatggagtgtaatattaccatat
attatatttaaacatgataagagcaagccatttgcaaaaaataattttattgataattta
aacgctgaattgtttaaaagccgttcatcacctactacgaatgttcaaaaaaaggatgtt
aaggaagaaactatgaatggttgtaaggttgaagggggttcattagaagtagcaaataaa
ttaagtgaaaaaaaaaatgcatcaacagtcacgaatatatcaaccgttactaatatttcc
aatgtatcaaaagtgaccagcataaaaagcaagtcgaatggttcaaaaaacaatcaaagc
gatgtgcaaaatgataaagaattaagcgaaggcacattgaatgtacacaaaaaagaaaaa
caaacggacgaagttatagtagtagaagatgaatatgaagatggaaatgaggaaaaaaaa
aagagtactggtaaaagatgtttgttaactaatggtcaggaggtaaatgaaaacaagaaa
agaaacaaaggtcaaggacatgaagatgaacgaaatgacaataatattgaaatagtagaa
ataaaagatgatgttgaagtgatagagatatctgagggagaagaaaaagagggaaaaaag
agagaaaatactgtgaatagtaacaaaagtagtagtaatagtaatagcaataataaaaaa
aataatataagtagtagtggctgtaatggtagtgataataataataataataatgttaca
caaacagatgtagcgtgttttccaaaagaatatgtaattaccaatgatctagttaaacag
gcaatatttgataccctcaataacgtaaataataaaaatgaagaagattattattctttt
cataatgatcatgatgttgtttatttatatgcagatttgcttaaggaaaaagaagataat
aatcgtaataataataataataatattttagatgaacaaaaagaagataaagataaagtt
aattccatcgaaaagtggaagagagaaagtgcttcaaagacaaatgtaatagaacgtttt
aatagtaagaaagaagaacagaatgacgaaagtagtgagtattgttattatttttattta
tttggtttagcaacaacttatacgttttttacatttcaatttgatagaaatagaatatct
caatttttgattttccctcccatgcaatgtaaagggttaggtatgcaggttttagaaaag
atttatcatttatcaattgttaatacaaatattagagaaataacggttgaagatccagca
gtttcattcactcaattaagagatatcattacaataaaaatgtgcattgatttaaatatt
ttatcaccgagtgttttatatccacaagaatatttaacaacaaaaaatattcaaaaggaa
aatgtggaattagataagaggaagtttatgacagtttgtaaagaaacacacaagcaaatt
actagaatgatcgaaactttaatgttagctgatgtattacctcatcctgctcctgcatat
acagataatgaggaaaaggttacaggccttaggaaaagagagaagaaaaatgataacagc
agttgtttaaattcaatggaatatttcgaatcttctgatttatgtaaacaagtgcgaata
aaaataaaaaagaggataaaaaatgattacataggaaatttgatcaacaaaaatatgaat
tgcatggccagtgacgtcttccaagattacgtgaaagaagaactatataagttgtggagg
aaacaatgtagagtttattataggactataagaaagttaagaaacatatatccattataa

DBGET integrated database retrieval system