KEGG   Plasmodium falciparum 3D7: PFD0805wHelp
Entry
PFD0805w          CDS       T00095                                 

Definition
prohibitin-like protein, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
4:733248..734111
Genome map
AA seq 287 aa AA seqDB search
MKRHFIKLKYDIRNVNYYHLHKINIRNIHNIIKNERAKNTDLSVNNNPRINEKKCVENEN
FIYPNINIDIKKNEMHIIDDKVERIKYEEKENENENENEKIKLLKVKNVKLLTCCIITTL
FFYFTLKKVPEGYVCLVQNKYDGKVIPYIYDDLMTFFFNPLKYKVIHMRIIPIQRKYTNV
YETLDKQKIKVKLEVKMKPKIPFIIDIYSTFGINYSTCYIEKEMNFDLKNVIKYYNLNTL
LENNQSVHDDNATVDDAIDQIMDRFYDSSIFHKIILMDVTILFEKVE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtcattttataaaattgaaatatgatataagaaatgtaaactattaccattta
cacaagataaatataagaaatatacataacataataaaaaatgaaagagctaaaaataca
gatttaagtgttaataataatccaagaataaatgaaaagaaatgtgtagaaaatgaaaat
tttatatatcctaatattaatattgatattaaaaaaaatgaaatgcatataatagatgat
aaagttgaaagaataaaatatgaagaaaaagaaaatgaaaatgaaaatgaaaatgaaaaa
ataaaattattaaaagtaaaaaatgtaaaattattaacctgttgtataattacaactctc
tttttttatttcacacttaaaaaagttcctgaaggttatgtatgcttagttcaaaataaa
tatgatggaaaagttataccatatatatatgacgatttgatgactttcttttttaatcct
ttaaaatataaagttatacatatgagaattatacctatacaaaggaagtatacaaatgta
tatgaaacattggataaacaaaaaattaaagtaaaattagaagttaaaatgaaacctaaa
ataccctttattattgatatttatagtacctttggtataaattatagtacctgttatatt
gaaaaagaaatgaattttgatttaaaaaatgttatcaaatattataacttaaatacatta
ctagaaaataatcaaagtgttcatgatgataatgctacagtggatgatgcaatagatcaa
attatggaccgcttttacgattcctctatattccacaaaattattcttatggatgttacc
atattatttgaaaaggtggaataa

DBGET integrated database retrieval system