KEGG   Plasmodium falciparum 3D7: PFD0805wHelp
Entry
PFD0805w          CDS       T00095                                 

Definition
prohibitin-like protein, putative
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PFD0805w
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFD0805w
   00670 One carbon pool by folate
    PFD0805w
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PFD0805w
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     PFD0805w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
4:733248..734111
Genome map
AA seq 287 aa AA seqDB search
MKRHFIKLKYDIRNVNYYHLHKINIRNIHNIIKNERAKNTDLSVNNNPRINEKKCVENEN
FIYPNINIDIKKNEMHIIDDKVERIKYEEKENENENENEKIKLLKVKNVKLLTCCIITTL
FFYFTLKKVPEGYVCLVQNKYDGKVIPYIYDDLMTFFFNPLKYKVIHMRIIPIQRKYTNV
YETLDKQKIKVKLEVKMKPKIPFIIDIYSTFGINYSTCYIEKEMNFDLKNVIKYYNLNTL
LENNQSVHDDNATVDDAIDQIMDRFYDSSIFHKIILMDVTILFEKVE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtcattttataaaattgaaatatgatataagaaatgtaaactattaccattta
cacaagataaatataagaaatatacataacataataaaaaatgaaagagctaaaaataca
gatttaagtgttaataataatccaagaataaatgaaaagaaatgtgtagaaaatgaaaat
tttatatatcctaatattaatattgatattaaaaaaaatgaaatgcatataatagatgat
aaagttgaaagaataaaatatgaagaaaaagaaaatgaaaatgaaaatgaaaatgaaaaa
ataaaattattaaaagtaaaaaatgtaaaattattaacctgttgtataattacaactctc
tttttttatttcacacttaaaaaagttcctgaaggttatgtatgcttagttcaaaataaa
tatgatggaaaagttataccatatatatatgacgatttgatgactttcttttttaatcct
ttaaaatataaagttatacatatgagaattatacctatacaaaggaagtatacaaatgta
tatgaaacattggataaacaaaaaattaaagtaaaattagaagttaaaatgaaacctaaa
ataccctttattattgatatttatagtacctttggtataaattatagtacctgttatatt
gaaaaagaaatgaattttgatttaaaaaatgttatcaaatattataacttaaatacatta
ctagaaaataatcaaagtgttcatgatgataatgctacagtggatgatgcaatagatcaa
attatggaccgcttttacgattcctctatattccacaaaattattcttatggatgttacc
atattatttgaaaaggtggaataa

DBGET integrated database retrieval system