KEGG   Plasmodium falciparum 3D7: PFE0215wHelp
Entry
PFE0215w          CDS       T00095                                 

Definition
(RefSeq) ATP-dependent helicase, putative
  KO
K16911  
ATP-dependent RNA helicase DDX21 [EC:3.6.4.13]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PFE0215w
Ribosome biogenesis [BR:pfa03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    PFE0215w
Chromosome [BR:pfa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    PFE0215w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
5:172150..174417
Genome map
AA seq 755 aa AA seqDB search
MKSLFFNKLKNVGKKIKINFIQILIIFLVYVNLDFFKSNINVKAIHTKKNLFIPVSNEIF
YFKKNVLIKKRNKEKRYTHSKNKGSNIFLNLNEENDNTVKERKKKIKYPEIGEYNDDVNH
NKNNDNNGDDSESHLNDQGKCKFSDLSEINKNIVEFLENKKGIKYMTKIQSQSFKPIYEG
KDIIGRSETGSGKTLAFALPLVEKLYKMKTSNEKFEEENGSHEEDQKKNIYDDVDNDNNY
DNFSYGKKYQNREHNKDPSILVLEPTRELSKQVENTFKEISQFYNFNIMSIYGGESYTYQ
ENKLRKGIDILTGTPGRIIDHIEKKNLSLQNIKYVVLDEADEMLNLGFTHDIERILSNIN
LKEAQVLLYSATTPSWIKDISSKYLKNPFCIDVVDSSNKTAKNIKHIAIKTPYDIKEKAL
LLEDIILVKSNGGQVIIFTRTKLEADILCSEGSFKSLSFAVLHGNIAQSTREYTMQRFRQ
GMFQILIATDIASRGLDISNVDLVIQCFPPNYSAVYIHRAGRTGRANKKGTSLVLYSNED
KQDLIKIEKNCGIKFNMETLPNNEQVFHCASAIASKKVENVNKEILPFFHDTAKELINKS
NSLKIDQIELISRCLAIIAKKEHIKKRSLINGLSETVTLNFINKNRKWSSEADIVYWVNK
LSNELNVNTFNKILQIKIDNKDRASSFFDINENLAELFLQNFKTMSKIEYRKMFDLSVAQ
TIPEHVDLTIDYQPHTSRYQYRKKNYSYRRRPSYY
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattattttttaataaactaaaaaatgttggtaagaaaataaaaattaacttt
atccaaatcttgataatatttcttgtatatgtaaatttagattttttcaagagcaacata
aatgttaaggcaatacatacgaagaagaatttatttatacctgtaagtaacgaaatattt
tattttaaaaaaaatgtgttaataaaaaaaaggaataaggaaaaaaggtatacacattct
aaaaacaaaggatcgaatatattcttaaatttgaatgaagaaaatgataatacagtaaaa
gaaaggaaaaaaaaaattaagtatccagaaataggagaatataatgatgacgtaaaccat
aataaaaataatgataataatggtgatgattcagaaagtcatttaaatgatcaagggaaa
tgtaaattttccgatttgtctgaaataaataaaaatattgtcgaatttttagaaaacaaa
aaaggtattaaatatatgactaaaatacaatcacaaagttttaaacctatatatgaaggt
aaggatattattggacgttcagaaactggttcagggaaaaccttagcatttgctttaccc
ttggttgaaaaattgtataaaatgaaaacatccaatgaaaaatttgaagaagaaaatggt
tcacatgaagaagatcaaaagaaaaatatatatgacgatgttgataatgataataattat
gataatttttcatatggtaaaaaatatcaaaatcgagaacataataaagatccatccata
ttagtattggaacctactcgcgaattgtctaaacaagttgaaaatacctttaaagaaatt
agccaattttataattttaatattatgtctatttatggaggtgaaagttatacgtatcaa
gaaaataaattgagaaaaggtattgatatattaacaggtactcctggacgtattattgat
catattgaaaaaaagaatttatccttacaaaatattaaatatgttgttttagatgaagct
gatgaaatgctgaatttaggttttacccatgatatagaacgaatattaagcaatataaat
ttaaaagaggcacaagttttgttgtattctgctacgacaccatcatggataaaagatatc
tcatcaaaatatttgaagaatccattttgtatagatgtagtagattcatctaataagact
gcaaaaaatataaaacacattgctattaaaacaccatatgatataaaggaaaaggctttg
ttattagaagatataatattagttaaatctaatggtggacaagttattatttttacacgt
actaaattagaagcagatattctatgttctgaagggtcctttaaatcattatcatttgct
gtcttacatggtaatatagctcaatctactagagaatataccatgcaaagatttagacaa
gggatgtttcaaatattgatagcaaccgatattgcttcaagaggattagatattagtaat
gttgatttagttattcaatgttttcctcctaattattcagctgtatatatacatagggca
ggtaggacgggaagagctaataaaaagggaacatctctagtattatattcaaatgaagat
aaacaagatttaataaaaattgagaaaaattgtggtattaaatttaatatggaaacatta
ccaaataacgaacaagtatttcattgtgcttcagctattgcatctaaaaaagttgagaat
gtcaataaagaaattttaccattttttcatgatacagctaaagaattaatcaataaatcg
aattctttaaaaattgatcaaatagaattaatatctagatgtctagccattattgcaaaa
aaagaacatataaaaaaaagatcacttattaatggattgtcagaaacggttaccttaaac
tttataaataaaaatagaaaatggagtagtgaagctgatattgtatattgggttaataaa
ttatcaaacgaattaaatgtaaacacttttaataaaatactccaaattaaaatagataat
aaagatagagcttcctcattttttgatattaatgaaaacttagcagaattatttttacaa
aattttaaaaccatgtctaaaatcgaatatagaaaaatgtttgatttatccgttgctcaa
actatacctgaacatgtagatttaacaatcgattaccaaccacatactagtagatatcaa
tatagaaaaaaaaattattcatatagaagacgaccttcttattattaa

DBGET integrated database retrieval system