KEGG   Plasmodium falciparum 3D7: PFE0215wHelp
Entry
PFE0215w          CDS       T00095                                 

Definition
ATP-dependent helicase, putative (EC:3.6.1.3)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PFE0215w
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     PFE0215w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
5:172150..174417
Genome map
AA seq 755 aa AA seqDB search
MKSLFFNKLKNVGKKIKINFIQILIIFLVYVNLDFFKSNINVKAIHTKKNLFIPVSNEIF
YFKKNVLIKKRNKEKRYTHSKNKGSNIFLNLNEENDNTVKERKKKIKYPEIGEYNDDVNH
NKNNDNNGDDSESHLNDQGKCKFSDLSEINKNIVEFLENKKGIKYMTKIQSQSFKPIYEG
KDIIGRSETGSGKTLAFALPLVEKLYKMKTSNEKFEEENGSHEEDQKKNIYDDVDNDNNY
DNFSYGKKYQNREHNKDPSILVLEPTRELSKQVENTFKEISQFYNFNIMSIYGGESYTYQ
ENKLRKGIDILTGTPGRIIDHIEKKNLSLQNIKYVVLDEADEMLNLGFTHDIERILSNIN
LKEAQVLLYSATTPSWIKDISSKYLKNPFCIDVVDSSNKTAKNIKHIAIKTPYDIKEKAL
LLEDIILVKSNGGQVIIFTRTKLEADILCSEGSFKSLSFAVLHGNIAQSTREYTMQRFRQ
GMFQILIATDIASRGLDISNVDLVIQCFPPNYSAVYIHRAGRTGRANKKGTSLVLYSNED
KQDLIKIEKNCGIKFNMETLPNNEQVFHCASAIASKKVENVNKEILPFFHDTAKELINKS
NSLKIDQIELISRCLAIIAKKEHIKKRSLINGLSETVTLNFINKNRKWSSEADIVYWVNK
LSNELNVNTFNKILQIKIDNKDRASSFFDINENLAELFLQNFKTMSKIEYRKMFDLSVAQ
TIPEHVDLTIDYQPHTSRYQYRKKNYSYRRRPSYY
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattattttttaataaactaaaaaatgttggtaagaaaataaaaattaacttt
atccaaatcttgataatatttcttgtatatgtaaatttagattttttcaagagcaacata
aatgttaaggcaatacatacgaagaagaatttatttatacctgtaagtaacgaaatattt
tattttaaaaaaaatgtgttaataaaaaaaaggaataaggaaaaaaggtatacacattct
aaaaacaaaggatcgaatatattcttaaatttgaatgaagaaaatgataatacagtaaaa
gaaaggaaaaaaaaaattaagtatccagaaataggagaatataatgatgacgtaaaccat
aataaaaataatgataataatggtgatgattcagaaagtcatttaaatgatcaagggaaa
tgtaaattttccgatttgtctgaaataaataaaaatattgtcgaatttttagaaaacaaa
aaaggtattaaatatatgactaaaatacaatcacaaagttttaaacctatatatgaaggt
aaggatattattggacgttcagaaactggttcagggaaaaccttagcatttgctttaccc
ttggttgaaaaattgtataaaatgaaaacatccaatgaaaaatttgaagaagaaaatggt
tcacatgaagaagatcaaaagaaaaatatatatgacgatgttgataatgataataattat
gataatttttcatatggtaaaaaatatcaaaatcgagaacataataaagatccatccata
ttagtattggaacctactcgcgaattgtctaaacaagttgaaaatacctttaaagaaatt
agccaattttataattttaatattatgtctatttatggaggtgaaagttatacgtatcaa
gaaaataaattgagaaaaggtattgatatattaacaggtactcctggacgtattattgat
catattgaaaaaaagaatttatccttacaaaatattaaatatgttgttttagatgaagct
gatgaaatgctgaatttaggttttacccatgatatagaacgaatattaagcaatataaat
ttaaaagaggcacaagttttgttgtattctgctacgacaccatcatggataaaagatatc
tcatcaaaatatttgaagaatccattttgtatagatgtagtagattcatctaataagact
gcaaaaaatataaaacacattgctattaaaacaccatatgatataaaggaaaaggctttg
ttattagaagatataatattagttaaatctaatggtggacaagttattatttttacacgt
actaaattagaagcagatattctatgttctgaagggtcctttaaatcattatcatttgct
gtcttacatggtaatatagctcaatctactagagaatataccatgcaaagatttagacaa
gggatgtttcaaatattgatagcaaccgatattgcttcaagaggattagatattagtaat
gttgatttagttattcaatgttttcctcctaattattcagctgtatatatacatagggca
ggtaggacgggaagagctaataaaaagggaacatctctagtattatattcaaatgaagat
aaacaagatttaataaaaattgagaaaaattgtggtattaaatttaatatggaaacatta
ccaaataacgaacaagtatttcattgtgcttcagctattgcatctaaaaaagttgagaat
gtcaataaagaaattttaccattttttcatgatacagctaaagaattaatcaataaatcg
aattctttaaaaattgatcaaatagaattaatatctagatgtctagccattattgcaaaa
aaagaacatataaaaaaaagatcacttattaatggattgtcagaaacggttaccttaaac
tttataaataaaaatagaaaatggagtagtgaagctgatattgtatattgggttaataaa
ttatcaaacgaattaaatgtaaacacttttaataaaatactccaaattaaaatagataat
aaagatagagcttcctcattttttgatattaatgaaaacttagcagaattatttttacaa
aattttaaaaccatgtctaaaatcgaatatagaaaaatgtttgatttatccgttgctcaa
actatacctgaacatgtagatttaacaatcgattaccaaccacatactagtagatatcaa
tatagaaaaaaaaattattcatatagaagacgaccttcttattattaa

DBGET integrated database retrieval system