KEGG   Plasmodium falciparum 3D7: PFE0215wHelp
Entry
PFE0215w          CDS       T00095                                 

Definition
ATP-dependent helicase, putative (EC:3.6.1.3)
Orthology
K16911  
ATP-dependent RNA helicase DDX21 [EC:3.6.4.13]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PFE0215w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
5:172150..174417
Genome map
AA seq 755 aa AA seqDB search
MKSLFFNKLKNVGKKIKINFIQILIIFLVYVNLDFFKSNINVKAIHTKKNLFIPVSNEIF
YFKKNVLIKKRNKEKRYTHSKNKGSNIFLNLNEENDNTVKERKKKIKYPEIGEYNDDVNH
NKNNDNNGDDSESHLNDQGKCKFSDLSEINKNIVEFLENKKGIKYMTKIQSQSFKPIYEG
KDIIGRSETGSGKTLAFALPLVEKLYKMKTSNEKFEEENGSHEEDQKKNIYDDVDNDNNY
DNFSYGKKYQNREHNKDPSILVLEPTRELSKQVENTFKEISQFYNFNIMSIYGGESYTYQ
ENKLRKGIDILTGTPGRIIDHIEKKNLSLQNIKYVVLDEADEMLNLGFTHDIERILSNIN
LKEAQVLLYSATTPSWIKDISSKYLKNPFCIDVVDSSNKTAKNIKHIAIKTPYDIKEKAL
LLEDIILVKSNGGQVIIFTRTKLEADILCSEGSFKSLSFAVLHGNIAQSTREYTMQRFRQ
GMFQILIATDIASRGLDISNVDLVIQCFPPNYSAVYIHRAGRTGRANKKGTSLVLYSNED
KQDLIKIEKNCGIKFNMETLPNNEQVFHCASAIASKKVENVNKEILPFFHDTAKELINKS
NSLKIDQIELISRCLAIIAKKEHIKKRSLINGLSETVTLNFINKNRKWSSEADIVYWVNK
LSNELNVNTFNKILQIKIDNKDRASSFFDINENLAELFLQNFKTMSKIEYRKMFDLSVAQ
TIPEHVDLTIDYQPHTSRYQYRKKNYSYRRRPSYY
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattattttttaataaactaaaaaatgttggtaagaaaataaaaattaacttt
atccaaatcttgataatatttcttgtatatgtaaatttagattttttcaagagcaacata
aatgttaaggcaatacatacgaagaagaatttatttatacctgtaagtaacgaaatattt
tattttaaaaaaaatgtgttaataaaaaaaaggaataaggaaaaaaggtatacacattct
aaaaacaaaggatcgaatatattcttaaatttgaatgaagaaaatgataatacagtaaaa
gaaaggaaaaaaaaaattaagtatccagaaataggagaatataatgatgacgtaaaccat
aataaaaataatgataataatggtgatgattcagaaagtcatttaaatgatcaagggaaa
tgtaaattttccgatttgtctgaaataaataaaaatattgtcgaatttttagaaaacaaa
aaaggtattaaatatatgactaaaatacaatcacaaagttttaaacctatatatgaaggt
aaggatattattggacgttcagaaactggttcagggaaaaccttagcatttgctttaccc
ttggttgaaaaattgtataaaatgaaaacatccaatgaaaaatttgaagaagaaaatggt
tcacatgaagaagatcaaaagaaaaatatatatgacgatgttgataatgataataattat
gataatttttcatatggtaaaaaatatcaaaatcgagaacataataaagatccatccata
ttagtattggaacctactcgcgaattgtctaaacaagttgaaaatacctttaaagaaatt
agccaattttataattttaatattatgtctatttatggaggtgaaagttatacgtatcaa
gaaaataaattgagaaaaggtattgatatattaacaggtactcctggacgtattattgat
catattgaaaaaaagaatttatccttacaaaatattaaatatgttgttttagatgaagct
gatgaaatgctgaatttaggttttacccatgatatagaacgaatattaagcaatataaat
ttaaaagaggcacaagttttgttgtattctgctacgacaccatcatggataaaagatatc
tcatcaaaatatttgaagaatccattttgtatagatgtagtagattcatctaataagact
gcaaaaaatataaaacacattgctattaaaacaccatatgatataaaggaaaaggctttg
ttattagaagatataatattagttaaatctaatggtggacaagttattatttttacacgt
actaaattagaagcagatattctatgttctgaagggtcctttaaatcattatcatttgct
gtcttacatggtaatatagctcaatctactagagaatataccatgcaaagatttagacaa
gggatgtttcaaatattgatagcaaccgatattgcttcaagaggattagatattagtaat
gttgatttagttattcaatgttttcctcctaattattcagctgtatatatacatagggca
ggtaggacgggaagagctaataaaaagggaacatctctagtattatattcaaatgaagat
aaacaagatttaataaaaattgagaaaaattgtggtattaaatttaatatggaaacatta
ccaaataacgaacaagtatttcattgtgcttcagctattgcatctaaaaaagttgagaat
gtcaataaagaaattttaccattttttcatgatacagctaaagaattaatcaataaatcg
aattctttaaaaattgatcaaatagaattaatatctagatgtctagccattattgcaaaa
aaagaacatataaaaaaaagatcacttattaatggattgtcagaaacggttaccttaaac
tttataaataaaaatagaaaatggagtagtgaagctgatattgtatattgggttaataaa
ttatcaaacgaattaaatgtaaacacttttaataaaatactccaaattaaaatagataat
aaagatagagcttcctcattttttgatattaatgaaaacttagcagaattatttttacaa
aattttaaaaccatgtctaaaatcgaatatagaaaaatgtttgatttatccgttgctcaa
actatacctgaacatgtagatttaacaatcgattaccaaccacatactagtagatatcaa
tatagaaaaaaaaattattcatatagaagacgaccttcttattattaa

DBGET integrated database retrieval system