KEGG   Plasmodium falciparum 3D7: PFE0555wHelp
Entry
PFE0555w          CDS       T00095                                 

Definition
stearoyl-CoA Delta 9 desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PFE0555w
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PFE0555w
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PFE0555w
Lipid biosynthesis proteins [BR:pfa01004]
 Desaturase
  First
   PFE0555w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
5:join(471053..472144,472299..474056)
Genome map
AA seq 949 aa AA seqDB search
MIEMILSYVYKSLAGVLHTLNKSYLDIKDIGVTYLTYFIFLISCYLLKNYFSFKFLNFIR
IVKSSIVLIICLISLKYLDLNLTLSINFFYLYNILQLSNFLEVSTSQNKKSNNKSKNVEA
KVINKYELRNENEEKNYELIGDTSKHLEKIAKKILNNKKKLEENECILKEKEIIDEIERK
EKEEEEIMKMKNNLNAKKNKDKRKDKINLYGIYVFFLQTFYIYFFYFFWNYIQNLIIIKI
FLTLQLVKCLISFVSNFWINNMNINLFKRMIHILDIVYMFSISLFFTNILYNISQNTHFL
RNFAVYSIVFHVYYAYVLFVKYIYTYHKQFRSSLFSFILFFHVFGIIGMIKLYYHEYGKS
LLIQCVIFYLINGFGITFGAHRLWSHRAFKAGHIVQVLFLILNSFANQGSVIVWAINHRL
HHKYSDTKYDPHNIRYGFFYSHVGWLLYQKTKYVKEKEKEIYVDDLLQNPYLLLQHKLDP
YFNFFFCFIIPGIYSYFMYNNFWDGFFILGALRWIITLHATWSINSASHSFGHRPYNIDI
KPTNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYLINFFYYLGLVWDLKC
AKNICKEVRLRETLKLEKRNKALSENIKNEIMKKEDTSYVIELMNSFKALCNDYLNISTF
MYILYFLRDIVIMITIFLIHICYCYNKYGNGTMFSTISQKFNIENNKYISISLSFFFHII
LYTLPMGTMFASLYALVYECKRELLFKKPLFNHFFGSIISSFILLPYTSEKNRKSVLTAL
NEDFVKILKGPIYFDIYSLIFTFFSVFYIMTYYIFGYFYFCTFFLGPYIVFNAWLLIYIY
LLKNPPFLQMDINTKEVDIGVLNYVAFQSLLQWKKNNSIYQSKKRLYKMVFSFINFIHHH
LCYTHVVEFINASIPSYRTKEIYKHFDKTLDQYNFLRNDKFMDVLKEFL
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatgatcttaagttatgtatataaatcgttagcaggtgtattgcacacgtta
aacaaaagttatttagacattaaagacataggtgtaacctatttaacctattttattttt
ttaatttcatgttatttattaaagaattatttttcatttaagtttcttaattttataaga
attgtaaaaagttccatagttctaataatatgtttaataagtttaaaatatttagatttg
aacctgaccttaagtattaactttttttatttatacaacattttacagttaagtaacttt
ttagaagtaagtacatcacaaaataaaaaaagcaataacaaatcaaaaaatgtagaggca
aaagtaattaataaatatgaattaagaaatgaaaatgaagaaaaaaattatgagttaatt
ggagatacatcaaaacatttagaaaaaattgcaaaaaaaatattaaataataaaaaaaaa
ttagaagaaaatgaatgcatattaaaagaaaaagaaattattgatgaaatagaaagaaaa
gaaaaagaagaagaagaaattatgaaaatgaaaaataatcttaatgctaaaaaaaataaa
gataaaagaaaggacaaaataaatttatatggtatttatgttttctttttacaaaccttt
tatatatattttttttatttcttttggaattatattcagaacttgattattataaaaata
ttcttaactttacaattagttaaatgtctcatttcttttgttagtaatttctggataaat
aatatgaatataaatttattcaaaagaatgatacatatattagacatcgtatatatgttt
tctataagtttattttttacaaatattctgtacaatatatcacaaaatacacatttctta
cgtaactttgcagtatactctattgtatttcatgtatattatgcatatgtcctatttgtt
aagtatatatacacatatcataagcagtttagatcatctttattttcttttattttgttc
ttccacgtatttggaataattggaatgataaaattatattatcacgagtatggaaagtca
ttattaattcagtgcgtaatattttacctcataaacggtttcggaataacatttggagct
catcggttatggtcacatagggcatttaaagctggtcacattgttcaggttttattttta
attttgaatagttttgctaatcaagggagtgtaatagtttgggccataaatcatcgttta
catcataaatacagtgatacaaaatatgatcctcataatataagatatggcttcttttat
agtcacgttggatggcttttatatcagaaaacgaaatatgtaaaagaaaaagagaaagaa
atttatgtagatgatttattacaaaatccttatcttctcttacaacacaaattagatcca
tattttaattttttcttttgttttattatacctggtatatattcatattttatgtataat
aatttttgggatggattttttatattaggagctcttcgttggattattactttacatgct
acatggtctattaatagtgcatcacattcttttggacatagaccctataatattgatata
aaaccaaccaataatatttttacatctatagtagcccttggagaaggatgtcataattat
catcatgtgtttccttactgttatgccatgaatgaaaatttttatattcttagtataaac
cctacgaaatatctgataaattttttctattatttaggtttagtatgggatttaaaatgt
gcaaagaatatttgtaaagaagtacgattaagagaaacattaaaattagaaaagagaaat
aaagcattaagtgaaaacattaaaaatgaaataatgaaaaaagaagatacaagttatgtt
atagaattaatgaattctttcaaagcattgtgtaatgattatttaaatatttcaaccttt
atgtacattttatacttcttaagagatattgtaattatgattactatatttttaattcac
atatgttactgttataataaatatggaaatggtacgatgttttctacaatatcacaaaaa
tttaatatagaaaataataaatatatatcaatatcactttcctttttctttcatattatt
ttatatacactacccatgggaactatgtttgcaagtttatatgcattagtttatgaatgt
aaaagagagctactttttaaaaaaccactatttaatcatttctttggtagtattatttca
tcatttattttgttaccatatacttcagagaaaaatagaaaatcagtattaacagcgttg
aatgaagatttcgttaaaattttaaaggggccaatatattttgacatatattctttaata
tttacctttttttcagtattctatataatgacatattatatatttgggtacttttatttc
tgtacattttttttaggaccatatattgtttttaatgcatggttattaatttatatatat
ttattaaaaaatcctccatttttacaaatggatattaatactaaagaagtggatattggt
gttttaaattatgttgctttccaatcattacttcaatggaaaaaaaataattcaatatat
caaagtaaaaagaggttatataaaatggttttttcatttataaatttcatacatcatcac
ttatgttatactcatgttgttgaattcattaatgctagcataccaagttacagaactaaa
gaaatatataaacattttgataaaaccttagatcagtataatttcctacgcaatgacaaa
tttatggacgtactaaaggaattcttatga

DBGET integrated database retrieval system