KEGG   Plasmodium falciparum 3D7: PFE0835wHelp
Entry
PFE0835w          CDS       T00095                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2, putative (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFE0835w
Peptidases [BR:pfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PFE0835w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
5:join(694490..694614,694771..695176,695309..698776)
Genome map
AA seq 1332 aa AA seqDB search
MDTLSNTNTPNKNVLLDKIQILNLFKIFDNLPFEPKSDNEIWYIVNKEFIDNLRYYECGK
SDTYSNIINNKIFLEDCSNVNIKSRIVKEYENSNGVDFLLYPEKAIEILEKHFIFDIKIP
RAVYAYKTNRKEKIIYKVDIQPLKIIVYSKNPNEHSNPSKMKIVILRNDTLESVLKEIVG
NIDRSTFKKNLFYADELDNKREKTWKCLYICNSIEYDLTKKVCDYSIDETCCLLITSERP
DIKCIMNKSNYNASYGKKEGHNRRMEIESSLKNNNNEDEEGNENYYFDDDNNNMSEMEKR
RISYIFDKGGDRGLINLGNTCFLNSSLQCLSKILKFSNYFLNGSFWNHINYSNPVGQHGR
LAKAYYETLTEMWKINKRDCPYAPKVLKEAISEKRDEFYGYQQHDSQELLAFLLDGLHED
LNLIRKKPYYEEKLQGGVDKLDVDVAEASWNRHKEINNSIIVDLFQGQYRSRLQCPKCKK
VSITFDPFMYLSIPLPPKKNHRVWFHVILSRDIPIAIRFSCTFNGSQEVLKLKIFFLNII
KNMKNKKRNILLHSKSIIKNNKYPHEGANAFNFHSKFLDDNKNDLYEENEYNNNNNISDD
VTNYIKALKNKSKITNTLKEQDIQIIYESICSMCNISSIEELEINNLCFLYTKLKNLACN
NFFQVLNNSDFVTEPHTRNGKGISHIFVYILPKIFGHLIDKNIDLKVDECLEVLTNSTVT
TNNTSLKDEEDINIRTETNDKKTVKNKHSTNKIVKKRKGLLSNPLRKGTLGTDHQKYYQE
DNVEENIENVNEINIKEEDNKIINNNNDHIKKNSNEYISYNDLLNDQAFINHNYHYLNDK
YFSVLIVPLCKDEQLLYKMKNNDLPLLYNIPFNYTLEELYNKVKYSYNKNNHIKTSTMKI
YNYSKMEQNDMSNSLYHKNKNVESPKKDNTLNGTGPNMDIYQNDDNDNNNMNVNGCKNVE
PCYNLDDKINSNSKNMNSNDINMNNNDINMNSHNINMNNNDINMNSHNINMNSHDINMNS
NDINMNSHNINMNSNDINMNSHNINNNNNNNNNNNVNDVNVNSYNDFLDKFSLYLPCYNL
KEEWNPKDNLGLELKRDGTYLSDYIKNSEEKRLIIIYLNTVGMEEELSLDIKTLTFVDLE
EKYGIDTCLKLFSEEEHLDENNTWYCSNCKLHVQAYKKLDLFRMPIILILHLKRFNNTNR
WLRTKIDSYVYYPHKDKEYLNMAPYILQDGLKHMTKLNPKYAPLYELIGVNCHTGSLCGG
HYFAYVKLNDQWYNFNDSCVSTIDEAEVNTKNAYLLFYQLISHKNEKFSGYAQTRNLAEQ
QAILMANASYYN
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggatacgttatctaatacaaatacccctaacaaaaatgtattactagataagatacag
attttaaacttatttaaaatttttgataatttaccatttgaaccaaaaagtgataatgaa
atatggtatatagtaaataaagagttcatagataatttaagatactatgagtgtggaaaa
agtgacacttattcaaatattataaacaataaaatatttttagaagattgtagtaatgta
aatataaaaagtaggatagttaaagaatatgaaaatagtaatggtgtggattttctttta
tacccagaaaaggctatagaaatattagaaaaacattttatttttgatataaaaattcca
agagctgtatatgcttataaaacaaatagaaaagaaaaaataatatataaggttgatata
caaccattaaaaattattgtatattcaaaaaatcctaatgaacattccaatccttcaaaa
atgaaaattgtgattttaagaaatgatacccttgaaagtgttttaaaggagattgttggg
aatattgataggagcacattcaagaagaatttattttacgcagatgaattagacaacaaa
agagaaaagacgtggaagtgcttatacatatgtaatagtatagaatatgatttaacaaaa
aaggtatgtgattattctatcgacgaaacgtgttgtttattaataacaagtgaaagacct
gatatcaaatgtataatgaataaaagtaattataatgcaagttatggtaaaaaggaagga
cataatagaaggatggaaattgagagtagtttaaaaaataataataatgaagatgaagaa
ggaaatgagaattattattttgacgatgacaataataatatgagtgaaatggaaaaaaga
cgaattagttatatatttgataaaggaggtgatcgaggtcttataaatttaggaaataca
tgttttttaaattcatcattacaatgtttatctaagattttaaaattttcaaattatttt
ttaaatggttctttttggaatcatataaattattcaaatccggttggtcaacatgggaga
ttagcaaaagcatattatgagactttaacagaaatgtggaaaattaataaaagagattgt
ccttatgcacctaaggttttaaaagaggcgataagtgaaaagagggatgaattttatgga
tatcaacaacatgattcacaagaattattagcatttctattagatggattacatgaagat
ttaaatttgattagaaaaaaaccttattatgaagagaagttacaagggggtgtagataaa
ttagatgttgatgtagctgaagcttcttggaatagacataaagaaattaataattccata
attgtcgatttatttcaaggtcaatatagatcaagattacagtgtcctaaatgtaaaaaa
gttagtataacatttgatccttttatgtatttatccattccattacctccaaaaaaaaat
catcgagtatggtttcatgtgatactaagtagagatattcctatagctatcagattttca
tgtacatttaatggttcgcaagaagtattaaaattaaaaattttctttttgaatataata
aagaatatgaaaaacaaaaaaagaaatatattattacatagtaaatccataatcaaaaat
aataaatatcctcatgagggtgccaatgcattcaatttccattcgaaatttttagatgat
aataagaatgatttatatgaagaaaatgaatataacaataataataatataagtgatgat
gttactaattatattaaagctttgaaaaataaatccaaaattaccaacactctgaaagaa
caagatatacaaataatatatgaaagcatttgttctatgtgtaatatatcttctattgaa
gaattagaaattaataatctttgttttctttatacgaaattaaaaaatctagcatgtaat
aatttttttcaagtgttaaataattccgattttgttacagaaccacatacaagaaatggt
aagggcattagccatatctttgtttatatacttcctaaaatatttggacatttaattgat
aaaaatattgatttaaaagtagacgagtgtttagaagtattaacgaattcaactgttact
acaaataatacgagtcttaaagatgaagaagatattaatataagaacagaaacgaatgat
aagaaaactgtaaaaaataaacattctactaataaaattgtaaaaaaaagaaaaggatta
ttatccaaccctttaagaaaaggaacacttggaacagatcatcaaaaatattatcaagaa
gataatgttgaagaaaatatagaaaatgttaatgaaataaatattaaagaagaagataat
aaaattataaataataataatgatcatattaaaaaaaattcaaacgaatatatatcttat
aatgatttattaaatgatcaagcttttataaatcataattatcattatcttaatgacaaa
tatttttctgttcttattgtgccattgtgtaaagatgaacaacttttatacaaaatgaaa
aataatgatttacctttattatataatattccttttaattacaccttagaagaattatat
aataaggtgaaatattcatataacaaaaataatcatataaaaacatcaacgatgaaaatt
tataattattcaaagatggaacaaaatgacatgagcaattcattatatcataagaataaa
aacgttgaaagtccgaagaaggataatactttaaatggaactggtcccaatatggatatc
tatcaaaatgatgataatgataataataatatgaatgttaatggttgtaaaaatgtggaa
ccttgttacaaccttgacgataaaattaatagtaatagtaaaaatatgaacagtaatgat
attaatatgaacaataatgatattaatatgaacagtcataatattaatatgaataataat
gatattaatatgaacagtcataatattaatatgaacagtcatgatattaatatgaacagt
aatgatattaatatgaacagtcataatattaatatgaacagtaatgatattaatatgaac
agtcataatattaataataataataataataataataataataatgtaaatgatgtaaac
gttaatagttataatgatttcttagataaatttagtttatatttaccatgctataattta
aaagaagaatggaatccaaaagataatttaggattagaattaaaaagagatggtacgtat
ttatcagattatataaaaaattctgaagaaaaaagacttatcataatatatttaaatact
gtaggtatggaagaggaattatccttagatattaaaacattaacatttgttgatttagaa
gaaaagtatggtatcgatacatgtttaaaattattttcagaagaagaacatctagatgaa
aataatacgtggtattgtagtaattgtaaattacatgtgcaagcatataaaaaattagat
ttattccgtatgcctattatattaatattacatttaaaaagatttaataataccaataga
tggttaagaacaaaaattgattcttatgtatattatccccataaagataaagaatatcta
aatatggcaccatatatattacaagacggattaaaacatatgactaaattaaatccaaaa
tatgctccactctatgaattaattggagtcaattgtcatacgggtagtttatgtggaggt
cattattttgcatatgttaaattaaatgatcaatggtataattttaatgattcttgtgtg
tcaacaattgatgaagctgaggttaataccaaaaatgcttacctcttattttatcagtta
atatctcataagaatgagaaattttccggatatgctcaaaccaggaatttggctgaacaa
caggcaatccttatggcaaacgcaagttattataattaa

DBGET integrated database retrieval system