KEGG   Plasmodium falciparum 3D7: PFE0885wHelp
Entry
PFE0885w          CDS       T00095                                 

Definition
eukaryotictranslation initiation factor 3 subunit, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pfa  Plasmodium falciparum 3D7
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PFE0885w
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     PFE0885w
Translation factors [BR:pfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PFE0885w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
5:743177..745327
Genome map
AA seq 716 aa AA seqDB search
MVRVSDNELSDKELVDFLSEDSDNGDENLLNKKYSDKEALITLEVDFPKIVTILGIPKVE
SEKHGRLAEVLKKLFIRHLSAKISDSSLLNMKIHMPTDEENKTKGICFVTFNDSFQANEA
VKILNKLKLDAKHILTTSKMDDIENIINRDEKAMPINVVGFTREKIRWWLYDEKCREQFI
VRYDSHFEVHWFDPLEKEPQLIYTTFKKNAPFSSVQWSNQGSYLVSFHNPGIALWGGDSF
EKLIRLQHKSVKEIMFSPNENYVLTWDGTPYSLRNEKSICIWRVITGKLLRSFITPEYSP
KEKMFPHFLWSPDDKYIACIGKQKEVYVYELPSMLLIEDQEKKRTPLKYSGVKEFDWSPV
DNILAIWIPQTNDTPGTLILVDVPSRKELVSRKIYDVSVASIHWHNKGDYLCLKTTIQKK
SGKKIKKEYTQLEIFRMREKNIPVDNVQIEAVKTKQFHWEESNSNRFALILREETTNKQQ
IRFYKISNKGTARDAKWSSTFDINNQMNFMKWSPQGTYFILASLASEGTLYFCCLNNNDE
VDVIHKDEHLLVNSISWSRCGRFLVSAVSNNPNAFNTGYREENSEAGFHIWTFQGKCLMR
IKKPSFIQFLFRPHPKSLFNDKLKLDIKNNLNNYSKKFDNIDEKMKTAKKNALLTERKNV
ENSFNQKFQEITALFQSYQEYEQLKKNWETFENQFEWEEKTIVIEHVLSVKEEIFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggtacgagttagcgataacgaattgagtgataaggagttggtagattttttatcagaa
gatagtgataatggtgatgagaatttattaaataaaaaatattctgataaagaagcatta
ataactttagaagtagattttcctaagattgtaactatattaggtataccaaaagttgaa
tcagagaaacatgggaggttagctgaagtattgaagaaattatttataagacatttaagt
gctaagattagtgattcttctttattaaatatgaaaattcatatgcctactgatgaagag
aataaaaccaaaggtatatgttttgtaacgtttaatgatagttttcaagcaaatgaagct
gtgaagattttaaataaattaaaattagatgctaaacatatattaactacttcaaaaatg
gatgatatagaaaatattattaatagagatgagaaagctatgcctattaatgttgttggt
tttactcgagaaaaaattagatggtggctatatgatgaaaaatgtagagaacaatttatt
gttagatatgatagtcattttgaagtccattggtttgatcctttagaaaaagaaccgcaa
ttaatatatacgacttttaaaaaaaacgcacctttttcaagtgttcaatggagtaatcaa
ggttcttatttagttagctttcataatccagggatagctttatggggtggagatagtttt
gagaaattaattagattacaacataaaagcgttaaagaaatcatgttttctccgaacgaa
aattatgtattaacttgggatggtactccttattcattaaggaatgaaaaatctatttgt
atttggagagttatcacaggaaaattacttcgttcttttattactccagaatatagtcct
aaagaaaaaatgtttccacatttcttgtggagtccagatgataaatatattgcatgtata
ggaaaacaaaaagaagtctatgtgtatgaattaccatctatgttattaattgaagatcaa
gaaaaaaaaagaacacctctaaaatattcaggtgtaaaagaattcgattggtcacctgtc
gataatattctagctatatggattccacaaactaatgatacaccaggtacattaattctt
gttgatgtaccatctagaaaagaattagtttcaaggaaaatatatgatgtcagtgttgct
tctatacattggcataataaaggtgattatctatgtttaaaaacaaccattcaaaaaaaa
tcaggtaaaaaaatcaaaaaggaatatacacaactagaaatattccgtatgagagaaaaa
aacataccagtagataatgtacaaattgaagctgttaaaacaaaacaattccattgggaa
gaatcaaacagtaatcgttttgcacttatcctcagagaagaaacaactaataaacaacaa
atcagattctataaaatatccaataaaggaacagccagagatgctaaatggtccagtaca
tttgatatcaataatcaaatgaattttatgaaatggtcaccacaaggaacatattttata
ttagcatcattagcatcagaaggtacactctatttctgttgtttaaataataatgatgaa
gtagatgttatacataaagatgaacatctattagttaattctatatcctggagtcgttgt
ggaagattcctagtctcagctgtttccaataatccaaatgcttttaatactggttataga
gaagaaaatagtgaagcaggatttcatatatggacttttcaaggcaaatgtcttatgaga
attaaaaaaccatcatttattcaattcttatttagaccacatccaaagtcattatttaat
gataaacttaaactagatattaaaaataatctaaataattattcgaaaaaattcgataat
atagatgaaaaaatgaaaacagcaaagaaaaatgcattactcacagaaagaaaaaatgta
gaaaattcattcaaccaaaaatttcaagaaattactgcactcttccaatcctatcaagag
tatgaacaacttaaaaaaaattgggaaacattcgagaaccaatttgagtgggaagaaaaa
acaatagtcatcgagcatgtactgtctgtaaaggaggaaatatttgcctaa

DBGET integrated database retrieval system