KEGG   Plasmodium falciparum 3D7: PFE1355cHelp
Entry
PFE1355c          CDS       T00095                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFE1355c
Peptidases [BR:pfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PFE1355c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
5:complement(join(1132932..1134648,1134749..1134849))
Genome map
AA seq 605 aa AA seqDB search
MTLVNITVKWKNQVFNNIELDVSEPLILLKTQLWQLTNVPPEKQKLMYKGLLKDDVDLSL
LNIKENDKIMLVGSAESLVEKPKDIIFEEDLTNEEKQKIHTKENIIFEEQGIVNLGNTCY
FNAVLQFLTSFDDLGNFLRSYKSKESKLIKTNKDILFDSFIEFAHSFEKSSEPYVPVTLL
KSFRDVYPKFKSVNLRTKQYAQQDAEECMNAILTCLNEQTDNKIIDKLFSFQIISNMKFV
ETVEQHEQKEKKDEKKDEKKDEKKDEKKEEKKEEIKNINITSNNNNIDNNNDNNDNNNNN
NNNSVQQNDHNNKDISHNNIFETTQEFNNKLICYMGTPNTPVNHLHEGIRLSLHEKIRKN
RNEDNKECIYEKKSEINSLPPYLIVHFLRFESKKIVESNNSGVSVVTAKICRKVSFPDTF
DMYDFCSEKIKEELKIARDIIMKRKDKETSLSPQKENIQNIEQNNINNQYNQNNSNDNPK
HVQEHTNQINKEELIELPTGEYELISVITHKGRNEESGHYIAWKKMKKFFSSNSNIDQNE
SSNKKTKNANDSLWLKMDDDKVSTHKFSSIDFYGGCSDYNIAVLLLYKRKNISCTPDEMN
MDIKE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgacattggttaatataacggtaaaatggaaaaatcaggttttcaataacatagagctt
gatgtatctgagccgcttattttattaaaaactcagttgtggcaactgacgaatgtcccg
ccagaaaaacagaaattaatgtacaaaggattattgaaagatgatgttgatttatcttta
ttaaacataaaagaaaacgacaagattatgcttgtaggttccgcagaatcattagttgag
aaaccaaaagatataatatttgaagaagatttaacaaatgaagaaaaacaaaaaattcat
acaaaagaaaatattatatttgaagaacagggtattgttaatcttggaaacacatgttat
tttaatgcggtattacaatttttaacatcttttgatgatttaggaaattttcttagaagc
tataaatcaaaagaaagtaaattaattaaaacaaataaagatatattatttgattctttt
atagaatttgctcattcatttgagaaatcatcagaaccatatgttcctgtaactttgtta
aaatcttttagagatgtatatccaaaatttaaaagtgttaatttaagaacgaaacaatat
gcacaacaagatgctgaggaatgtatgaatgcaattttaacttgtttaaatgaacaaacg
gataataaaattatcgacaaattgttttcttttcaaattattagtaatatgaaatttgtg
gaaactgttgaacaacatgaacaaaaagaaaagaaggatgaaaagaaggatgaaaagaag
gatgaaaagaaggatgaaaaaaaggaagaaaaaaaggaagaaatcaaaaatataaatatt
acaagtaataataataatatcgacaacaataatgacaataatgacaataataataataat
aataataatagtgtacagcaaaatgatcataataataaagatatatcccataacaatatt
tttgaaactacacaagaatttaataacaaactaatatgttatatgggtacacctaataca
cccgtaaatcatctacatgaaggtatacggttatcattacatgagaaaataagaaaaaat
agaaatgaagataataaggaatgtatatatgaaaaaaagtcagaaattaattccttacct
ccttatttaattgtacatttcttacgatttgaatcgaaaaaaattgtagaatccaataat
agcggagtgtctgttgttacagccaaaatttgtagaaaagtttcatttcctgatactttt
gatatgtatgatttctgttcagaaaaaattaaagaggaactaaaaattgccagagatatc
attatgaaaagaaaggataaagaaacttcattatctcctcaaaaggaaaatatacaaaat
atagaacaaaataatatcaacaatcaatacaatcaaaataactctaatgataacccaaaa
catgtacaggaacatacaaaccaaataaataaagaagaacttattgaactacctacagga
gaatatgaacttatttcggtaattacacataaaggtagaaatgaagaaagtggtcattat
attgcttggaaaaaaatgaaaaaatttttttcttcaaattctaacatagatcaaaatgaa
tcaagtaataaaaaaactaaaaatgcaaatgattctttatggttaaaaatggatgatgat
aaagtcagcactcataaattctcttccatagatttctatggaggatgtagtgattacaat
atcgcagtcttattgttatataagagaaaaaatatatcatgtacaccagatgaaatgaat
atggatattaaggaataa

DBGET integrated database retrieval system