KEGG   Plasmodium falciparum 3D7: PFF1350cHelp
Entry
PFF1350c          CDS       T00095                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00010  Glycolysis / Gluconeogenesis
pfa00620  Pyruvate metabolism
pfa00640  Propanoate metabolism
pfa01100  Metabolic pathways
pfa01110  Biosynthesis of secondary metabolites
pfa01130  Biosynthesis of antibiotics
pfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFF1350c
   00620 Pyruvate metabolism
    PFF1350c
   00640 Propanoate metabolism
    PFF1350c
Enzymes [BR:pfa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PFF1350c
Lipid biosynthesis proteins [BR:pfa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PFF1350c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 3885698
NCBI-ProteinID: XP_966261
PlasmoDB: PFF1350c
GeneDB: PFF1350c
UniProt: C6KTB4
Position
6:complement(1114545..1117538)
Genome map
AA seq 997 aa AA seqDB search
MNNLKSYGSLSKVDSVQINGMDIDTNIFLNMNSYPTKEIYDDENNKNDGNHNIKNFQAYK
AMYEESINNPEAFWGNLAKNNLIWYKLFTKVFLGNFKKGNINWFVNGKINACENCVDRWV
EKDPNKIALIWEQDCPDQYKKITYQKLLEKTCKVANLLKLIGVKKQDTVTIYLPMIPELI
YSMLACVRIGAIHNVVFAGYSAASLSDRIIDSRSTVLITSDFGLRGGKLTKLKQIADVAM
DMCGMIQTCIVFKNKTKMKDKNIQIKTPMENPIYNFTSFDSNSAQNFTINNSNDFIQIKS
THSHQSDHQNDFSLQQEDNNYTKNSNMSYTTSMYYHDNNLNHINTNKNNDHYNNNLNNKN
YLNNNINDQSPMYVHTMNHNDNNDDNNNNNNNNNVDDDNNSNIQNDEQSYFNQQNNTYNK
NDHSDDNNKNKGKTTLHKKITKNNPINHKISYSEKSYSKELINTDMVNNDNQFGDLKTKK
KFININNIITCNQNGYSTNKQYFPEPDKNSTSNFDETLCVLKKGRDIDGTALLKNMRSYC
PIEYVDSEDFLFLLYTSGSTGKPKGVAHTTAGYLLYAYTTCKYIFDVKENDIFGCVADIG
WVTGHTYVLYGPLLNGITTVIFSSIPTYPDCGRYWSLIQTHKVTQFYTAPTALRALMKYG
DEWIQKYDLSSCRILGSVGEPINPETWRWYYNVVGKKKCTIVDTYWQTETGGIVIAPIPH
LFSMKPGCASLPFLGVQLEILDSKTLQPLSGNNVCGLLCIKSPWPGMLRTVYGNHQRLIK
TYFTMCPNYYFTGDGAFRDEDGYYWISGRIDDTLNVAGHRLGAAEIEHALVQHFYIAEAA
VVSFHHNVKGEGILCFVVKKKGDIKNYSKGITDIVNSNNNNNRNELHNNSPFLICSNNIT
DIEEFKKNFTDEKLIEQLKLYVRQVIGPIATPDLICVVPDLPKTRSGKIVRRILRCIANG
ITDFGDISTVSNYEVIETINNTLIECKKKLKHIEIKK
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttgaagagttatggaagtctatcaaaagtcgactctgttcaaatcaacggt
atggatatagatacaaatatttttcttaatatgaattcttaccctaccaaggaaatatat
gatgatgagaataataagaatgatggaaatcataacataaaaaatttccaagcatataaa
gcaatgtatgaagagagtataaataatccagaagctttttggggaaatttagcaaagaat
aatttaatatggtataaattatttactaaagtatttttaggtaattttaaaaaaggaaat
ataaattggtttgttaatgggaaaattaatgcttgtgaaaattgtgttgatagatgggtt
gaaaaagatcctaataaaattgcacttatatgggaacaagattgtccagatcaatataaa
aagattacatatcagaaattattagaaaagacttgtaaagtagctaatttattaaaactt
attggtgttaaaaaacaagacactgttactatttatttacctatgatacctgaattgatt
tattctatgctagcttgtgttcgtattggagctattcataatgtagttttcgctggttat
tcggcagctagcttgagcgatagaataatagattctagatctactgttttaattacttct
gattttggattgagaggtgggaaattaaccaaattaaaacaaattgctgatgtagctatg
gatatgtgtggaatgatacaaacatgcatagtattcaaaaataaaactaaaatgaaagat
aaaaatatacaaattaaaacacctatggaaaatcctatttataattttacaagttttgat
tctaatagtgcacaaaattttacaattaataattctaatgattttattcaaataaaatca
actcattcccatcaaagtgatcatcaaaatgatttctctcttcagcaggaagataataat
tatacaaaaaactctaatatgtcttatactacgagtatgtattatcatgataataattta
aaccatataaacactaataaaaataacgatcattataacaataatttaaataataaaaat
tatttaaataataatattaatgatcaaagccctatgtatgttcataccatgaaccataat
gacaataatgatgataataataataataataataataacaatgtagatgatgataataat
agtaatatacaaaatgatgaacaatcttattttaatcaacaaaataatacatataacaaa
aatgatcattctgatgacaataataagaataaaggaaaaacaaccttacataaaaaaatt
acaaaaaataatcctataaatcataaaatttcttactcagaaaaaagttactcaaaagaa
ttaataaacactgacatggtaaataacgataatcaatttggtgatttaaaaacaaaaaaa
aaatttataaatattaataatattataacttgtaatcagaatggatattctacaaataaa
caatattttcctgaacctgataaaaatagcacaagcaattttgatgaaactttatgtgtt
ttaaaaaaaggaagagatatagatggtactgctttattaaaaaatatgagatcttactgt
cctatagaatatgtagatagtgaagatttcttatttttattatatacatctggatcaact
ggtaaacctaaaggtgttgcacatacaacagctggatatttattatatgcatatacaaca
tgtaaatatatatttgatgtaaaagaaaatgatatatttggttgtgtagcagatataggt
tgggttaccggacatacatatgtattgtatggtcctttattaaatggtataactacagtt
attttttcttctataccaacatatccagattgtggtagatactggagtctaatacaaaca
cataaagtgacacaattttatacggctccgacagccttaagagcattaatgaaatatgga
gatgaatggatacaaaaatatgatctatcttcatgtcgtattttgggaagtgtgggtgaa
ccaatcaatccagaaacatggagatggtattataatgtagtaggtaaaaaaaaatgtaca
atagtagatacatattggcaaacagaaacaggtggtatcgttatagcacctataccacat
ttattcagtatgaaaccaggatgtgctagtttaccattcttaggtgttcaattagaaata
ttagattcaaaaactttacaacctttaagtggtaataatgtatgtggtttattatgtata
aagagcccatggccaggaatgttacgtacagtatatggaaatcatcaaagattaataaaa
acatattttaccatgtgtcctaattattattttaccggagatggagcgttcagagatgaa
gatggatactattggatatctggacgaatcgatgatacattaaatgtagcagggcacaga
ttaggagcagcagaaattgaacatgcactagttcaacatttttatattgctgaagcagct
gttgtttcatttcatcataatgttaagggagaaggaattttatgttttgtcgttaaaaaa
aaaggagacataaaaaattatagtaaaggtattacagatattgttaatagtaataataac
aataatagaaatgaattacataataatagtccatttttgatatgctctaataatattact
gatattgaagaatttaaaaaaaattttaccgatgaaaaattaatagaacaactaaaatta
tatgtaagacaagttattggacccatagcaacacctgacctaatttgtgtggttccagat
ttgccaaaaaccagaagtggaaaaattgttagaagaatattaagatgtatagcaaatggt
ataacagatttcggagatatttccactgtctctaattatgaagttattgaaactattaat
aatacacttattgaatgtaaaaaaaagttaaagcatattgaaattaagaaataa

DBGET integrated database retrieval system