KEGG   Plasmodium falciparum 3D7: PFI0320wHelp
Entry
PFI0320w          CDS       T00095                                 

Definition
arginase, putative (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFI0320w
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PFI0320w
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PFI0320w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
9:318308..319543
Genome map
AA seq 411 aa AA seqDB search
MLDTIESYIKSHKEKENLYVKKNVSIIGSPLAAGQPLGGVQLACDDLRKLGLHNVIDVLG
WKYEDIGNIDNGDNEMKQEKKTNNYINNNDNNNDNNNDNNNDNNNNCYIPNGVIKEKKHD
LSNNKMNGYVNHNFYGNYEENNVISTNDKYKNNCYYDNIRNIKEIGIFSKNLFDTMSNEL
RKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPETSPSGNYHGMTLAHT
LGLFKKKVPYFEWSENLTYLKPENTAIIGIRDIDAYEKIILKKCNINYYTIFDIEKNGIY
NTICTALEKIDPNSNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILAETKR
VVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLELIARVLGYDIV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgttggatactatagaaagttacatcaaaagtcacaaggaaaaggaaaacctttatgtt
aagaaaaacgtttccattattggttctcctcttgccgctggtcaacctcttggaggggtg
caattagcatgtgatgacttgagaaaattaggtttgcacaatgttatagatgtgttagga
tggaaatatgaagatataggcaatatagataatggggataatgaaatgaaacaagaaaaa
aaaactaataattatattaataataatgataataataatgataacaataatgataataat
aatgataataataataattgttatattcccaatggtgtaattaaagaaaagaaacatgat
ttgtcaaataataaaatgaatggatatgtgaaccataatttttatggtaattatgaagag
aataatgtaatatcaacaaacgataaatataaaaataattgttattatgataatataagg
aatataaaagaaataggtatattcagtaaaaatttatttgatactatgagcaatgaatta
aggaagaaaaattttgtattaaatatagggggtgaccatggtgtagcttttagtagtatc
ctgagttccttacaaatgtatcagaatttaagagttatatggattgatgcacatggtgat
ataaacatacctgaaacatctccttcaggtaattatcatggtatgactttagcacacacc
ttagggttatttaaaaagaaagttccttattttgaatggtccgaaaatttaacatattta
aaaccagaaaatacagctattataggtattagagatatagatgcatatgaaaaaattatt
ttaaaaaaatgtaatattaattattataccatttttgatatagaaaaaaatggaatctat
aatacaatatgtacagcattagaaaaaatagatccaaattcaaattgccctattcacatc
tctttagatatagatagtgttgataatgtctttgctccaggaactggtactgtagctaag
gggggattaaattatagagaaattaatttattaatgaaaatattagctgaaacaaaaaga
gttgtctctatggatttagtagaatataatccatcacttgatgaagttgataaaaaagtt
catggagattcattgcctatattggataatgcaacgaaaacaggcaagttgtgtttagaa
cttatcgcccgagtgttaggatacgatatagtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system