KEGG   Plasmodium falciparum 3D7: PFI0380cHelp
Entry
PFI0380c          CDS       T00095                                 

Definition
formylmethionine deformylase, putative (EC:3.5.1.31)
Orthology
K01462  
peptide deformylase [EC:3.5.1.88]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     PFI0380c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
9:complement(join(367858..368313,368513..368782))
Genome map
AA seq 241 aa AA seqDB search
MLMYYSLFLFNLIICCNVTSIYGYIHNVRSLEPYIKNDQIKNYSSNIKQKRKGSLYLLKN
EKDEIKIVKYPDPILRRRSEEVTNFDDNLKRVVRKMFDIMYESKGIGLSAPQVNISKRII
VWNALYEKRKEENERIFINPSIVEQSLVKLKLIEGCLSFPGIEGKVERPSIVSISYYDIN
GYKHLKILKGIHSRIFQHEFDHLNGTLFIDKMTQVDKKKVRPKLNELIRDYKATHSEEPA
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgtattattcacttttcctttttaatttaataatatgttgtaatgttacaagt
atttatggatatatacacaatgttagatcacttgaaccatatataaaaaatgatcagata
aaaaattatagtagtaatataaaacaaaagagaaaaggctctttatatttattaaaaaat
gaaaaggatgagataaaaatcgtcaagtacccggaccctatattaaggcgacgaagtgaa
gaagtcacaaattttgatgataatttgaagagagttgtgagaaaaatgtttgatattatg
tacgagagcaaaggtattggtttgtctgcaccacaagtaaatataagcaaacgaattatt
gtatggaatgcattatatgaaaaaagaaaagaagaaaatgaacgaatatttattaatccg
tccatagtagaacagagtctagttaaattaaaattaatagaaggatgtttatcatttcct
ggaatagaaggaaaagttgaacgacctagtatagtatctatatcatattatgatattaat
ggatataaacatttaaaaattttgaaaggtatacattctagaatatttcaacatgaattt
gatcatcttaatggtacattatttattgataaaatgacacaagtcgataaaaaaaaagta
agaccaaaacttaacgagctaattagggattataaggctactcactcagaagaaccagcc
ctataa

DBGET integrated database retrieval system