KEGG   Plasmodium falciparum 3D7: PFI0605cHelp
Entry
PFI0605c          CDS       T00095                                 

Definition
conserved Plasmodium protein, unknown function
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFI0605c
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PFI0605c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
9:complement(join(551417..552031,552433..553158))
Genome map
AA seq 446 aa AA seqDB search
MNTCIKLIFAFFIFIKYGRCQGDQVINEKLTNFVFLSCNYQKGKVNNNLLNSIEKRKPQL
MLWIGDYFYTECSEIKCLDDAYTYIKKDPFYMKLKKKFKIDGIYDDHDYNKNNGDRLYKY
KKESKKKYLDYLNVDKNDVRYKRNGAYISKLYIDPDNEKNQVKIIMLDTRYNKDPYPFYA
PDSYRDLFVHMFISFLSRFHSSIFGLCCNSKNDILGNEQWKWLERELTNSNARAHIIISS
TQIFSNHIINENWGLMPYSLRRLRELIKKTKPKGLLFLSGDVHFGSIIGKEESVIEVTSS
SVNQENIFSYINKYVIFFLTNILSKVSPFELNKIYSFNNFGSVNITYVNDNEIKIKTSVN
DSDGVEILVANQVFNNKNNIYTKTKDLHIILDEFATLECKSKTKVVMHTIVYILFLLWFL
QIIYIFLKVIGSLFRRKKIDTKTKDE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttgtataaaattaatttttgctttttttatttttattaaatatggccgatgt
caaggcgatcaagtaattaacgagaagctaacgaattttgtatttcttagttgtaactac
caaaaagggaaagtaaataataatttattaaattcaatagagaaaaggaaaccccagctt
atgctgtggataggtgattacttttatacagaatgtagcgaaataaaatgtttagatgat
gcttatacatatattaagaaagacccattttatatgaagctaaaaaagaagtttaaaatt
gatggtatttatgatgatcatgattataacaaaaataatggtgatcgattatataaatat
aaaaaagaaagtaaaaaaaaatacctagactatttaaatgtagataaaaatgatgtcaga
tataaaagaaatggtgcgtatatatccaaattatatatagatccagataatgaaaaaaac
caagttaaaattattatgttagataccagatataataaagatccttatcctttctatgcc
ccagattcatatagagatctttttgttcatatgtttatttcctttttgtcgcgtttccat
tcatccatttttggattatgttgtaatagtaaaaatgatattctaggaaatgagcaatgg
aaatggttagaaagggagttaaccaattcgaatgctcgtgcccacataattatatcctcc
acccagatattttccaatcacataattaacgagaattggggtttgatgccttactctttg
agacgtttaagggaactaataaaaaaaacgaaaccaaaaggtttattatttttaagtggg
gatgttcacttcggtagtataataggaaaggaagaaagtgtaatagaggttacaagtagt
agcgtaaatcaggagaacatttttagttatataaataaatatgttatattttttctaaca
aatatattaagtaaggtaagtccatttgagttgaataaaatatattcatttaataatttc
ggttcagttaatattacatatgtgaatgataatgaaataaaaattaagacatctgtaaat
gattcagatggtgtagaaatcttagtagctaatcaagtttttaataataaaaataatata
tatactaaaacaaaagatttacatattattcttgatgaatttgcaacattagaatgcaag
agtaaaacaaaggtcgtaatgcatacaatagtatatatattatttttattatggttctta
caaattatatatatatttctaaaagtaattggatcacttttccgcaggaaaaaaatcgac
acaaaaacaaaggatgaataa

DBGET integrated database retrieval system