KEGG   Plasmodium falciparum 3D7: PFI0755cHelp
Entry
PFI0755c          CDS       T00095                                 

Definition
6-phosphofructokinase, putative
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFI0755c
   01230 Biosynthesis of amino acids
    PFI0755c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFI0755c
   00030 Pentose phosphate pathway
    PFI0755c
   00051 Fructose and mannose metabolism
    PFI0755c
   00052 Galactose metabolism
    PFI0755c
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PFI0755c
Protein phosphatases and associated proteins [BR:pfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PFI0755c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
9:complement(650576..654832)
Genome map
AA seq 1418 aa AA seqDB search
MDTKSGDKNAANKGGADGLVKTVSVLLRDNKCQFNIDENYDHNDKEKLECEVGKRDSGMI
NCLMEKLTSKKFLEEKESKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERTKYIP
SLPKALASEYQILDENYGDEFINKNDYEDVKRFLKNLHNLPMLNVKDSNNNESFKGGNIL
KIGIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTITDSMMNRF
RNLGGFNMLWSGRGKVKNKDDLIAIENIVAKLKLNGLVIIGGDGSNSNAALMAEYFAERQ
IPISIIGVPKTIDGDLKSEAIEISFGFDTATRTYSEIIGNLCTDVKTGHNVYHVVRVMGR
SASHVVLECALQTRPNVVLIGEEVEQLNLSLKDIVKNIVNIILKRKSLNKNYGVILLPEG
LIEFVPEMKILISELNVILKDGPFDASKLQKSKEVWDFLPPIIRDQLLMDRESTGYIQVG
KIATERLIIVLVESELAKLNDKNLNIQFMSHYLGYEGRCAIPSNFDCNYCYALGYNAALL
IDHKKTGYMSIIRNLEDSYTNWIPAAIPFLRIMHVIKDNTGNEFPAVKRYLVDLNSPLFN
VLKEVRSLWSLYDLYRSPGPIQFNGHLGNARCYTVKTPTKDNLLCQNADDLELIINLTNK
NMYENNGDNNHNISDDKARDGGSSPTSSAKKTKYNLSDDNNNNNNNNINNVSTNYNNTSD
GSTFGNTTLLNTAYNVNGDGMNTLNCQKSNTSDVLSSEPVNQGFYEQHASSYKSLGCMSE
LQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFH
DKYASPISFEIRIGIVFLSRQAPGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLHNKYIII
DDDNIAKYVNQGGLELTGNSPEHSLFDKENRNKVCETVTKLQLNGLVMPGSNITITEAAL
LSEYFLEKKIPTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKY
WHFIRLMGRSPSHEVLECALQTHPNVVIISEEYGAADKTLWRVVQDIADVVCARADVGKN
YGTVLIPDALLMHLPHMKILLSEISDILNEASEKGQLLEARNDLVNLSGVDHGHLTSEWV
SKLTPWSLALLKTFPQFIIKELLQVDLRSMRFEQLETEQLLLQMVKEELQDRKQKGKYSG
SFMGLTHFFGYQGRSSLPSEFDCKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKL
FAIPFISLMKILPKGQGSKYLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRF
CNPGPIQFEGNASNYYNRILFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNVFVQ
LCGMLVLAYKPNDILSNMPYIGSIEDYYDWENQRKRMN
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atggataccaagagtggagataaaaatgctgcaaataagggaggagctgatgggcttgta
aagactgtgtcagtattactacgagataacaaatgtcagtttaatattgatgaaaattat
gatcataatgataaagagaaattagagtgtgaggtaggtaaacgtgatagtggtatgata
aattgtttgatggagaaattgacatctaagaaatttttagaagagaaagaaagtaaaaat
agtttttatttagtagataatgaaaatatgaaaataaaaaaattaaaagaacatggtcat
tcagcttcattaaatgatgatttaagtccattacaatatgaaagaacaaaatatatacca
agcttacccaaagctttagctagtgaatatcaaatattagatgaaaattatggagatgaa
tttataaataaaaatgattatgaagatgtaaagaggtttttaaaaaatttacataattta
ccaatgctaaatgttaaagatagtaataataatgaatcatttaaaggtggaaatatttta
aaaattggtattattttatcgggtggtccagctcctggtggtcataatgtaatatctggt
atttatgattatgctaaacgatataatgaacaatcacaagttattggatttcttggtggt
attgatggtttatatagtaaaaattatgttactataacagatagtatgatgaatcgattt
cgtaatttaggtggttttaatatgttatggtcaggtagaggaaaagtaaaaaataaagat
gatttgattgctatcgaaaatattgtagccaaattaaaattaaatggtttagttattatt
ggtggtgatggctcaaatagtaatgctgctttaatggctgaatattttgctgaaagacaa
attcctatatccattattggtgtacctaaaactattgatggtgatttaaaaagtgaggct
atagaaattagctttggttttgatactgctactagaacatactcagaaattattggaaat
ttatgtactgatgtaaaaactggtcataatgtataccatgttgttcgtgttatgggtaga
tcagcatcacatgttgttttagaatgtgctttacaaacaagaccaaatgttgttctaatt
ggtgaagaagttgaacaattgaatttgtcccttaaagatattgttaaaaatattgttaat
attatattgaaaagaaaatcattaaataaaaattatggtgttatcttattacctgaaggt
ttaattgaatttgtacctgagatgaaaatattaatttctgaattaaatgttatattaaaa
gatggtccatttgatgcttcgaaacttcaaaagtctaaagaagtttgggatttcttacca
cctattattagagatcaattgttaatggatagagaatcaactgggtatattcaagttgga
aaaatcgcaaccgaaagattaattattgtattagtagaatctgaactagccaaattaaat
gataaaaacctaaatatacaatttatgtcacattatctaggttatgaaggtagatgtgct
ataccatcaaattttgattgtaattattgttatgcattaggttacaatgctgcactttta
attgatcataaaaaaacaggatatatgtcgattattagaaacttggaagattcatatacc
aattggataccagctgcaattccatttttacgaattatgcatgtaattaaagataacaca
ggtaatgaattcccagctgttaaaagatatttagttgatttaaatagtccattatttaat
gtattaaaggaagtaaggagtttgtggtctctttatgatttatatagatctccaggacct
atccaatttaatggccatttaggtaatgcacgttgttatactgtaaagactccaacaaag
gataatttgttatgtcagaatgccgatgatttagagcttattataaatctaactaacaag
aatatgtatgaaaataatggggacaataatcataatatatctgacgataaagcaagggat
ggtggatcatcaccaacaagttctgctaagaaaacaaagtacaatctaagtgatgataat
aataataataataataataatatcaataatgtaagcactaattataataatacatcagat
ggatccacctttggtaatactaccttattaaatacagcctataatgtaaatggtgatgga
atgaatactttaaattgtcaaaaaagcaatacatctgatgttttgtcttcagaacctgta
aaccaaggattttatgaacaacatgcatctagttataaatcattaggttgtatgtccgaa
ttacaaacatctaggttgtataataaattagaattgcccgaattatgttctgatttgaaa
gcaaaggttagagcaggaaaacagtatatatccaatgatccatatacacaaaaacaaatc
ttatcaaattaccctcatatgtcttatgagaacaaatttcagatacaagaaatatttcat
gataaatatgctagtcccatttcttttgaaataagaattggtatagtatttttatcaaga
caggctccaggtgctatgaatgtgttatgtggtttatataggcgtttgaaattattaaaa
ggtgtttgtattgcattttacggattatatggattattacataataaatacattataata
gatgatgataatatagcaaaatacgtaaatcaaggaggtttagaattaactggcaattct
ccagagcattcattatttgataaagaaaatagaaataaagtatgtgagacagttacaaaa
ttacaattgaatggtttagttatgccaggatctaatataactattacagaagctgcttta
ttatcagaatactttttagaaaaaaaaatacctacatctgttgttggtataccattaaca
ggatctaataatttgatacatgaattaatagagacatgtgttggttttgatagtagtaca
aaagtatatgcatcattaataggtaatgtattgacagatgctgtaagtatgcctaagtat
tggcattttattcgtttaatgggaagatctccatcacatgaggttttagaatgtgcttta
caaacacatccaaatgtagttattatatcagaagaatatggagctgcagataaaacatta
tggagagttgttcaagatattgctgatgttgtatgtgcacgagctgatgttggaaaaaat
tatggtactgtattaattccagatgctttattgatgcacttaccacatatgaaaatatta
ttatctgaaataagtgatatattaaatgaggcatcagaaaaaggccaattattagaagca
agaaatgatttagtaaatttatctggtgtggatcatggtcacttaacatcagaatgggtt
tctaaattaacaccatggagtttagcattattaaagacattcccacaatttattataaaa
gaattattacaggtagatttgagatctatgcgttttgaacaattagaaactgaacaatta
ttattacaaatggttaaagaagaattacaagatagaaagcaaaaaggaaaatattcagga
agtttcatgggcttaacacacttttttggttatcaaggacgttcatcattaccatcagaa
tttgattgtaagttagcatatgcatatggacatgcagcatcaatagttattgaaagtggc
ttaacaggatatattgtatctataagaggattatgtggtaatgttaaagattggaaatta
tttgctataccattcatatcattaatgaaaatattaccaaaaggacaaggaagtaaatat
ttaaaaagtgcatctaaaggtgatttaccagtaattcctagtgcacctgtagatttgaat
ggaaaagcttatagaagcttaaaaattgctttacaaaaatggcaaatggaagatcgtttt
tgtaatcctggaccaatacaatttgaaggtaatgcatctaattattataataggatatta
tttgaagaacaatctgaatattttgaaatgttaagatatgttgaatgttatgcaaatatt
ttaaaagatacttgtcgttttggtgtctcagctgattatctgaaaaatgtatttgtacag
ttatgtggtatgttggtattagcatataagcctaatgatatcttatctaatatgccatat
attggaagtatagaagattattatgattgggaaaaccagagaaaaagaatgaactaa

DBGET integrated database retrieval system