KEGG   Plasmodium falciparum 3D7: PFI1140wHelp
Entry
PFI1140w          CDS       T00095                                 

Definition
flavodoxin-like protein (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PFI1140w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
9:944116..946458
Genome map
AA seq 780 aa AA seqDB search
MFMRWNKISRYTLLSGMVVSFWLFYRSENFNLLRRLISKLRSLFPLFIKNNFLNNEIKNS
VKIYFGSQSGTAEEFAKELKANLNDLFHIQANIIDLEYFNKEEIKSFGIRIFIVATYGDG
EPTDNAVEFFKWLKSLNNDNDYFRNTKYSIMGLGSKQYKHFNKIAKKLDTFLLNFKAHQI
SETIYGDDDDNIYHDFEVWKNKFFMQLPKLLNMKNIPIYVPKEDIIELTSWRDMAEIKLD
IQYYDHLIEEDNKKEKNVVTENIINESVTNNQQLLNHNQNNLSINNKSNYISTDIIGKFY
FNHLTGKVISNTKLLKNVDLSNNGDKVNHINISIEDNIIYKAADNLSILTKNTKEVITWW
LKRLNIDEKEKTKKFTFVKRNKLIDNSFTMNDPKDDVKNETFNNDVNKGNNKTNIDYNSN
NNGNNNNNNNYNEYDDNHIYVPFPTPCSVEDALSYYCDLTTIPRLNILKKFKCFIKDIEE
LKMFNFILSNNQRNTFFNICKECDMTFIEFVDMFMQSAVFELSPFLQLIPRNTPKSYTIS
SSPKESKDILSLTVKKKQYCIHSLRRALKNLKTNDMFPKLNEQKLRELCSRRWFKGSSSY
YLTEELNVNDIVKFNIKPSKFVLPENIQSSHIIMIATGAGIAPFKAFLSEFIYYDQQIVK
DNFVRKGKRILFYGCRKREVDFLYEMEIMDALDKKHIDETYFAFSRDQESKIYVQDLILQ
KKELVWNLLQKGAYIYVCGNSNMSKDVNKTINSLPLHFKQNDKKFTKKLKKSGRYIYEIW
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgaggtggaataaaatatcacggtataccctattaagtggtatggtagtttcc
ttttggttattctatagatcagagaatttcaatttattgagaagattaattagcaagcta
agaagtttgttccctctttttataaaaaacaactttttaaataatgaaattaagaatagt
gtaaaaatatattttggtagtcagagtgggacagcagaagaatttgccaaagaattaaaa
gcgaacttgaatgatttatttcatatacaagcaaatattatcgatttagaatattttaat
aaagaagaaataaaatcttttggaatccgtatatttattgttgcaacgtatggagatgga
gaaccaacggataatgcagttgaattttttaaatggttaaaaagtttaaataatgataat
gattattttagaaatactaaatattccattatgggtttaggtagcaaacaatataaacat
tttaataagatagctaaaaaacttgatacatttcttttaaattttaaagctcatcaaatt
agtgaaactatttatggtgatgatgatgataatatatatcatgattttgaagtatggaaa
aataaattttttatgcaacttccaaaattattaaatatgaaaaatatacctatttatgta
cccaaagaagatattattgaattgacatcttggagagacatggcagaaattaagttagat
atacaatattatgatcatttaatagaagaagataataaaaaagaaaaaaatgtagtaaca
gaaaatattataaatgaaagtgttacaaataatcagcaattattgaatcataaccaaaac
aatttaagtattaataacaaatcaaattatataagtacagatataatagggaaattttat
tttaatcatcttacaggaaaagttatttccaatacaaaattattaaaaaatgtggattta
tcgaataacggagataaagttaatcatatcaatattagcattgaggataatattatttat
aaagctgcagataatttatctattttaacaaaaaatacaaaagaggtcattacctggtgg
ttaaaacgattaaacatagatgaaaaagagaaaacaaaaaaattcacctttgtaaaaaga
aataaattaatagataattcatttactatgaatgatccaaaggatgatgtaaaaaatgaa
acatttaacaatgatgttaataaagggaataataaaacaaatattgattataatagtaac
aataatggtaataataataataataataattataatgaatatgatgataatcatatatat
gtaccctttccaacaccatgtagtgttgaagatgcattatcatattattgtgatctaaca
actattccaagattgaatattttaaaaaagtttaaatgttttattaaagatatagaagaa
cttaaaatgtttaactttattttatctaacaatcaaaggaatacattctttaacatatgt
aaagaatgtgatatgacatttatagaatttgttgatatgttcatgcaaagtgctgtattt
gaattatctccatttttacaattaatacctaggaatactcctaaaagttatacaatttct
tcttctccaaaggaatcaaaagatatattatcattaactgttaagaagaaacaatattgt
atacattctcttagaagagcattaaaaaatttaaaaacaaatgatatgtttccaaaatta
aatgaacaaaagctacgagaactttgtagcagaagatggtttaagggatcatcctcatac
tatctaacagaagaattaaatgtaaatgatatagttaaattcaatataaaaccttccaaa
tttgttctcccagaaaatattcaatcatctcatattattatgattgctacaggtgcagga
attgcaccttttaaagctttcctgagcgagtttatatattatgatcaacaaattgtaaaa
gataattttgtaagaaaaggaaaaagaatattgttttatgggtgcagaaaaagagaagta
gacttcctctacgaaatggaaattatggatgctcttgacaagaaacatattgatgaaaca
tactttgcattctcacgagatcaagaaagtaaaatatatgtccaagatttaattcttcag
aaaaaggaacttgtatggaatttattacaaaagggtgcatatatttatgtttgtggaaat
agtaatatgagtaaagatgtaaacaaaaccattaatagtttgcctctccattttaaacaa
aatgataaaaaatttacgaaaaagttgaaaaaatctgggcgttatatctatgagatatgg
taa

DBGET integrated database retrieval system