KEGG   Plasmodium falciparum 3D7: PFI1420wHelp
Entry
PFI1420w          CDS       T00095                                 

Gene name
PfGK
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00230  Purine metabolism
pfa01100  Metabolic pathways
Module
pfa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PFI1420w (PfGK)
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PFI1420w (PfGK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 AAA_18 RsgA_GTPase AAA_14 AAA MMR_HSR1 ABC_tran AAA_17 RNA_helicase AAA_16 NTPase_1 TraI_2_C NB-ARC AAA_5 ATPase_2 Roc MobB NACHT
Motif
Other DBs
NCBI-GeneID: 813564
NCBI-ProteinID: XP_001352159
PlasmoDB: PFI1420w
GeneDB: PFI1420w
UniProt: Q8I2M1
Structure
PDB: 

Jmol
Position
9:1159866..1160465
Genome map
AA seq 199 aa AA seqDB search
MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVSCTTRKKREKEKEGVDYYFIDKTI
FEDKLKNEDFLEYDNYANNFYGTLKSEYDKAKEQNKICLFEMNINGVKQLKKSTHIKNAL
YIFIKPPSTDVLLSRLLTRNTENQEQIQKRMEQLNIELHEANLLNFNLSIINDDLTLTYQ
QLKNYLLNSYIHLNNHTRN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatttatcccctggttatttgtggtccttcgggtgttggtaaaggtaccttg
ataaaaaagctgttgaatgaatttccaaattatttttatttttccgtaagctgtacgaca
agaaaaaagagagagaaagaaaaagaaggtgtagattattatttcatagataagactata
tttgaagataaattaaaaaatgaagattttttagaatatgataattatgctaataatttt
tatggaacattaaaaagtgaatatgataaagcaaaagaacaaaataaaatctgcttattt
gaaatgaatattaatggtgtcaaacaattgaaaaaatcaacacatataaaaaatgctctc
tatatatttattaaaccaccaagtactgatgtactcttaagtagattattaacaagaaat
acagaaaatcaagaacaaatacaaaaacgtatggaacaattgaatatcgaattacatgaa
gcaaacttattaaattttaatttatcaattattaatgatgatttaacattaacatatcaa
cagctcaaaaattatttacttaattcatacattcacttgaataatcacacaaggaattaa

DBGET integrated database retrieval system