KEGG   Plasmodium falciparum 3D7: PFI1420wHelp
Entry
PFI1420w          CDS       T00095                                 

Gene name
PfGK
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PFI1420w (PfGK)
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PFI1420w (PfGK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
9:1159866..1160465
Genome map
AA seq 199 aa AA seqDB search
MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVSCTTRKKREKEKEGVDYYFIDKTI
FEDKLKNEDFLEYDNYANNFYGTLKSEYDKAKEQNKICLFEMNINGVKQLKKSTHIKNAL
YIFIKPPSTDVLLSRLLTRNTENQEQIQKRMEQLNIELHEANLLNFNLSIINDDLTLTYQ
QLKNYLLNSYIHLNNHTRN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatttatcccctggttatttgtggtccttcgggtgttggtaaaggtaccttg
ataaaaaagctgttgaatgaatttccaaattatttttatttttccgtaagctgtacgaca
agaaaaaagagagagaaagaaaaagaaggtgtagattattatttcatagataagactata
tttgaagataaattaaaaaatgaagattttttagaatatgataattatgctaataatttt
tatggaacattaaaaagtgaatatgataaagcaaaagaacaaaataaaatctgcttattt
gaaatgaatattaatggtgtcaaacaattgaaaaaatcaacacatataaaaaatgctctc
tatatatttattaaaccaccaagtactgatgtactcttaagtagattattaacaagaaat
acagaaaatcaagaacaaatacaaaaacgtatggaacaattgaatatcgaattacatgaa
gcaaacttattaaattttaatttatcaattattaatgatgatttaacattaacatatcaa
cagctcaaaaattatttacttaattcatacattcacttgaataatcacacaaggaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system