KEGG   Plasmodium falciparum 3D7: PFI1685wHelp
Entry
PFI1685w          CDS       T00095                                 

Gene name
PfPKAc, PfPKA, PKA
Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PFI1685w (PfPKAc)
Protein kinases [BR:pfa01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PFI1685w (PfPKAc)
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PFI1685w (PfPKAc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
9:join(1361924..1362050,1362235..1362392,1362633..1362817,1362955..1363114,1363439..1363837)
Genome map
AA seq 342 aa AA seqDB search
MQFIKNLQLNKKKDSDSSEQVLTNKKNKMKYEDFNFIRTLGTGSFGRVILATYKNGNYPP
VAIKRFEKCKIIRQKQVDHVFSERKILNYINHPFCVNLHGSFKDDSYLYLVLEFVIGGEF
FTFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFA
KIVETRTYTLCGTPEYIAPEILLNVGHGKAADWWTLGIFIYEILVGCPPFYANEPLLIYQ
KILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFSNIDWVNLLNK
NVEVPYKPKYKNIFDSSNFERVQEDLTIADKITNENDPFYDW
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttattaaaaatttgcagctaaataaaaagaaggacagtgattctagtgaacag
gtgttaactaataagaaaaataaaatgaaatatgaagattttaatttcattcgtacactt
ggaacgggttcctttggtagagttattctcgctacctataaaaacggaaactacccacca
gtagccattaaacgttttgaaaagtgtaaaattataagacaaaaacaagtggatcatgtt
ttttcagagagaaaaatattaaattatataaatcatccattttgtgtaaatttacatgga
tcattcaaagatgactcttacttatatttagtccttgaattcgtaattggtggagaattt
tttacatttttaagaagaaacaaaagatttcctaatgatgttggatgtttttatgcagct
cagattgttctaatttttgaatacttgcaaagtttaaatattgtttatagagatttgaaa
cctgaaaatttattacttgataaagatggatttataaaaatgactgattttggatttgct
aaaatagtcgagacgagaacttatactttatgtggaactccagaatatatcgctccagaa
attttattgaacgtcggacatggaaaagccgctgattggtggactttaggtattttcata
tacgaaatattagttggatgtccccctttttatgcgaatgaacccttattaatttatcag
aaaatattagaaggtataatatatttccctaaatttttagataacaattgcaaacatttg
atgaagaaattgttgtctcacgatttaacaaaaaggtatggtaatttaaaaaaaggagct
caaaatgttaaagaacacccatggtttagtaatattgattgggtaaatttgttgaataaa
aatgttgaggttccatataaacctaaatataaaaatatttttgattcctccaattttgag
agggtacaagaagatttaactatagctgataaaataacaaatgaaaatgatccattttat
gattggtag

DBGET integrated database retrieval system