KEGG   Plasmodium falciparum 3D7: PFI1685wHelp
Entry
PFI1685w          CDS       T00095                                 

Gene name
PfPKAc, PfPKA, PKA
Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PFI1685w (PfPKAc)
Protein kinases [BR:pfa01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PFI1685w (PfPKAc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
9:join(1361924..1362050,1362235..1362392,1362633..1362817,1362955..1363114,1363439..1363837)
Genome map
AA seq 342 aa AA seqDB search
MQFIKNLQLNKKKDSDSSEQVLTNKKNKMKYEDFNFIRTLGTGSFGRVILATYKNGNYPP
VAIKRFEKCKIIRQKQVDHVFSERKILNYINHPFCVNLHGSFKDDSYLYLVLEFVIGGEF
FTFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFA
KIVETRTYTLCGTPEYIAPEILLNVGHGKAADWWTLGIFIYEILVGCPPFYANEPLLIYQ
KILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFSNIDWVNLLNK
NVEVPYKPKYKNIFDSSNFERVQEDLTIADKITNENDPFYDW
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttattaaaaatttgcagctaaataaaaagaaggacagtgattctagtgaacag
gtgttaactaataagaaaaataaaatgaaatatgaagattttaatttcattcgtacactt
ggaacgggttcctttggtagagttattctcgctacctataaaaacggaaactacccacca
gtagccattaaacgttttgaaaagtgtaaaattataagacaaaaacaagtggatcatgtt
ttttcagagagaaaaatattaaattatataaatcatccattttgtgtaaatttacatgga
tcattcaaagatgactcttacttatatttagtccttgaattcgtaattggtggagaattt
tttacatttttaagaagaaacaaaagatttcctaatgatgttggatgtttttatgcagct
cagattgttctaatttttgaatacttgcaaagtttaaatattgtttatagagatttgaaa
cctgaaaatttattacttgataaagatggatttataaaaatgactgattttggatttgct
aaaatagtcgagacgagaacttatactttatgtggaactccagaatatatcgctccagaa
attttattgaacgtcggacatggaaaagccgctgattggtggactttaggtattttcata
tacgaaatattagttggatgtccccctttttatgcgaatgaacccttattaatttatcag
aaaatattagaaggtataatatatttccctaaatttttagataacaattgcaaacatttg
atgaagaaattgttgtctcacgatttaacaaaaaggtatggtaatttaaaaaaaggagct
caaaatgttaaagaacacccatggtttagtaatattgattgggtaaatttgttgaataaa
aatgttgaggttccatataaacctaaatataaaaatatttttgattcctccaattttgag
agggtacaagaagatttaactatagctgataaaataacaaatgaaaatgatccattttat
gattggtag

DBGET integrated database retrieval system