KEGG   Plasmodium falciparum 3D7: PFL0595cHelp
Entry
PFL0595c          CDS       T00095                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PFL0595c
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PFL0595c
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PFL0595c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
12:complement(join(534906..535055,535225..535395,535613..535909))
Genome map
AA seq 205 aa AA seqDB search
MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMS
KFKNKVLIIFNSASKCGLTKNHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDIC
TFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDENGTLKSIGWNFGKFLVDKNG
EVVNYFSPKTNPLDLEKIIIQLLQK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctcaatgtttattaaattcattttacctatatcttttatatgctacaatttt
ggaaagaaatttaatatgtttagttattttcaaaaaatcaaagtatcagaacaggaatta
ttatcatccatttatgattatgaagtaaaggatttatcaggatcaaatgtatccatgtct
aaatttaaaaacaaagttttgattatttttaattctgcttcaaaatgtggattaacaaaa
aatcatgtagaacaatttaataaattacatgaaaaatataacgcaagaggattggagatc
ttagctttccccacaagtcaatttttaaatcaagaatttgacaacacaaaagatatttgt
acatttaatgaaaagaacaaaataaaatataatatgttttcacccattgaagtaaatggg
gataatacacacccactctttaaatacttaaaaaaaaattgtgattcgatgcatgatgaa
aatggaacgttaaaaagtatcggatggaattttggaaaatttctcgtcgataaaaatgga
gaagttgtaaattatttttcacccaaaacaaacccgttagatttagaaaaaattataatt
caattactacaaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system