KEGG   Plasmodium falciparum 3D7: PFL0595cHelp
Entry
PFL0595c          CDS       T00095                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pfa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pfa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
12:complement(join(534906..535055,535225..535395,535613..535909))
Genome map
AA seq 205 aa AA seqDB search
MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMS
KFKNKVLIIFNSASKCGLTKNHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDIC
TFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDENGTLKSIGWNFGKFLVDKNG
EVVNYFSPKTNPLDLEKIIIQLLQK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctcaatgtttattaaattcattttacctatatcttttatatgctacaatttt
ggaaagaaatttaatatgtttagttattttcaaaaaatcaaagtatcagaacaggaatta
ttatcatccatttatgattatgaagtaaaggatttatcaggatcaaatgtatccatgtct
aaatttaaaaacaaagttttgattatttttaattctgcttcaaaatgtggattaacaaaa
aatcatgtagaacaatttaataaattacatgaaaaatataacgcaagaggattggagatc
ttagctttccccacaagtcaatttttaaatcaagaatttgacaacacaaaagatatttgt
acatttaatgaaaagaacaaaataaaatataatatgttttcacccattgaagtaaatggg
gataatacacacccactctttaaatacttaaaaaaaaattgtgattcgatgcatgatgaa
aatggaacgttaaaaagtatcggatggaattttggaaaatttctcgtcgataaaaatgga
gaagttgtaaattatttttcacccaaaacaaacccgttagatttagaaaaaattataatt
caattactacaaaaatga

DBGET integrated database retrieval system