KEGG   Plasmodium falciparum 3D7: PFL1155wHelp
Entry
PFL1155w          CDS       T00095                                 

Gene name
GTP-CH
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
12:974364..975533
Genome map
AA seq 389 aa AA seqDB search
MYKYTSINKSDKIYETHNMEEKKKKGNNNNFSGLLNNEIDDNNKKEKLKNSISKMYSNHK
NRENFNECEKEDLVVIDEKDNNKKKKKNMTNTFEQDNNYNMNDNKRLGSFFKINDKCESI
NENVNNINKQSLKDSILFDNINEKEYFNETKEENKEGNKSNDIEKINCMKVKKKTVKKNK
KKINKIINNKNKISKSNDIEEQIINISKHIYKILNISKLPKCDILKRTNRRYAETFLYLT
NGYNLDIEQIIKRSLYKRMYKNNSIIKVTGIHIYSLCKHHLLPFEGTCDIEYIPNKYIIG
LSKFSRIVDVFSRRLQLQEDLTNDICNALKKYLKPLYIKVSIVAKHLCINMRGVKEHDAK
TITYASYKAEKENPTVHSLNIDSSVENLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatatacgtcaataaacaaatctgataaaatatatgaaacacataatatggaa
gaaaaaaaaaaaaaaggtaataataacaatttctcaggattattaaataatgaaatcgat
gataataataaaaaggaaaagttaaaaaatagtatatctaaaatgtatagtaaccataag
aatagagaaaattttaacgaatgtgagaaggaagaccttgttgtgatagatgaaaaggat
aataataaaaagaaaaaaaaaaatatgacaaatacatttgaacaagataataattataat
atgaatgataataaaaggttaggtagcttttttaaaataaatgataaatgtgaatctatt
aatgagaatgttaataatattaataaacagtctcttaaggattctatactatttgacaat
ataaatgagaaagaatattttaacgaaaccaaagaagaaaataaggaaggaaataaaagt
aatgatatagaaaagataaattgtatgaaagtgaagaagaaaactgttaaaaagaataaa
aagaagattaataaaattataaacaataagaataaaatatctaaatcaaatgacatagaa
gaacaaataattaatattagtaaacatatatataaaatattaaatatatccaaattacca
aaatgtgatatattaaaaagaacaaatagaagatatgctgaaacatttttatatttaact
aatggttataatctggatatagaacaaataataaaaagatctttatataaaaggatgtat
aaaaataattcaataatcaaagttacaggtatacatatatattcattatgtaaacaccat
cttttaccttttgaaggtacatgtgatattgagtatatacccaataaatatattatcggg
ttatctaaattttcaagaatagttgatgtcttttctagaagattacaattacaagaagat
ttaactaacgatatttgtaacgctttaaaaaaatacttaaaaccattatatattaaagta
tctattgtagctaaacatttatgtataaatatgaggggagttaaagagcacgatgctaaa
actataacgtatgcatcttataaagcagaaaaagagaatcctacagttcattctttaaat
attgactcttctgtggaaaatttaaattag

DBGET integrated database retrieval system