KEGG   Plasmodium falciparum 3D7: PFL1155wHelp
Entry
PFL1155w          CDS       T00095                                 

Gene name
GTP-CH
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00790  Folate biosynthesis
pfa01100  Metabolic pathways
Module
pfa_M00841  Tetrahydrofolate biosynthesis, mediated by PTPS, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFL1155w (GTP-CH)
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PFL1155w (GTP-CH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 811283
NCBI-ProteinID: XP_001350637
PlasmoDB: PFL1155w
GeneDB: PFL1155w
UniProt: Q8I5H7
Position
12:974364..975533
Genome map
AA seq 389 aa AA seqDB search
MYKYTSINKSDKIYETHNMEEKKKKGNNNNFSGLLNNEIDDNNKKEKLKNSISKMYSNHK
NRENFNECEKEDLVVIDEKDNNKKKKKNMTNTFEQDNNYNMNDNKRLGSFFKINDKCESI
NENVNNINKQSLKDSILFDNINEKEYFNETKEENKEGNKSNDIEKINCMKVKKKTVKKNK
KKINKIINNKNKISKSNDIEEQIINISKHIYKILNISKLPKCDILKRTNRRYAETFLYLT
NGYNLDIEQIIKRSLYKRMYKNNSIIKVTGIHIYSLCKHHLLPFEGTCDIEYIPNKYIIG
LSKFSRIVDVFSRRLQLQEDLTNDICNALKKYLKPLYIKVSIVAKHLCINMRGVKEHDAK
TITYASYKAEKENPTVHSLNIDSSVENLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatatacgtcaataaacaaatctgataaaatatatgaaacacataatatggaa
gaaaaaaaaaaaaaaggtaataataacaatttctcaggattattaaataatgaaatcgat
gataataataaaaaggaaaagttaaaaaatagtatatctaaaatgtatagtaaccataag
aatagagaaaattttaacgaatgtgagaaggaagaccttgttgtgatagatgaaaaggat
aataataaaaagaaaaaaaaaaatatgacaaatacatttgaacaagataataattataat
atgaatgataataaaaggttaggtagcttttttaaaataaatgataaatgtgaatctatt
aatgagaatgttaataatattaataaacagtctcttaaggattctatactatttgacaat
ataaatgagaaagaatattttaacgaaaccaaagaagaaaataaggaaggaaataaaagt
aatgatatagaaaagataaattgtatgaaagtgaagaagaaaactgttaaaaagaataaa
aagaagattaataaaattataaacaataagaataaaatatctaaatcaaatgacatagaa
gaacaaataattaatattagtaaacatatatataaaatattaaatatatccaaattacca
aaatgtgatatattaaaaagaacaaatagaagatatgctgaaacatttttatatttaact
aatggttataatctggatatagaacaaataataaaaagatctttatataaaaggatgtat
aaaaataattcaataatcaaagttacaggtatacatatatattcattatgtaaacaccat
cttttaccttttgaaggtacatgtgatattgagtatatacccaataaatatattatcggg
ttatctaaattttcaagaatagttgatgtcttttctagaagattacaattacaagaagat
ttaactaacgatatttgtaacgctttaaaaaaatacttaaaaccattatatattaaagta
tctattgtagctaaacatttatgtataaatatgaggggagttaaagagcacgatgctaaa
actataacgtatgcatcttataaagcagaaaaagagaatcctacagttcattctttaaat
attgactcttctgtggaaaatttaaattag

DBGET integrated database retrieval system