KEGG   Plasmodium falciparum 3D7: PFL1525cHelp
Entry
PFL1525c          CDS       T00095                                 

Definition
pre-mRNA splicing factor RNA helicase, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
12:complement(1301089..1304595)
Genome map
AA seq 1168 aa AA seqDB search
MNEKSDLHKRSIEFTDNDESKKKIKTDGEENDIMESKGKDSYSLYLEYQKGRNKKLKNNE
EYIEYLKKDARRKYLKEREKEKLDITKKLLDDELLYSTVKLEGKDLKELQFSKKIYNIAK
ENINLREKLQEESYYFQQDIDKNKKTQTYENDKVDKSLYNYDEQILNKGILKFGSAISKQ
NIQKQNNNEFVFDDDIITTNRKSIKRESFEEKKMNESPTKKKKKRKDDIESDNKCDKDEK
YDKYGKFYKRDKHHKYDKHDKHDKYDKHDKHDKHDKHDKHDKHDKHDKNDKHDKHDKHDK
HDKHNKKYHSKYKELNTSYDNNSPTDSTYKSEEESSSSGDKNHRNNKYDSDKIKHEKKKK
KKSIMTDEERNVDSNKRSFEKKESELNENGLTDVVEFVHLESFYGMNEKEKELEKLFEDI
KKRKEKKMKKIIDERKRLPIYSYRYDILKAIKNNKILILVGETGSGKSTQLTQYLYECKY
HMYGNIICTQPRRIACIAIANRVAEEMNVKIGKEVGYVIRFQNKTSEATKIMYMTDGMFL
RLLLYNPTLEDISVLIIDEAHERALHTDVILPIVKDICNFRENIRVVISSATLDAEKIST
YFNCAPIFYVPGRKYNVDIYYTINNESNYISAIVITILQIHITQGKGDILVFLPGQYEIE
LVQQELENKLNELAPKYRNLVILPIYSSLPVEYQARIFEDVTEEDNMKFLEDINDKKDER
NKNHKDDENDENGENEKNDKNEKNDKNDKNYKNEKNEKNNDKNDKNNVGNNSKMNVSQSK
NKRNINEEIEELKRINTNNKIRRKIILSTNICETSITIDNIVYVIDSGLCKQKIYNPNSG
IESLVTLPCSKASVNQRTGRAGRKRDGKCFRLFTKKSFIDLSDNSIPEIQRCEISSMILL
LKSLGMDDIINFDFLDPPSPIVIIKGLELLYSLGALNDEGNLTRTGRKMAEFPTDVKSSK
MILSAAEKYNCVDEILNVASMLTHANNIFYVQKGKEKEAENIKKMFIIEGGGDFLLFLNI
YKQCEENNFSTSFCYDHFLQYHTLIKVKDVKTQLLSICEKIDIPITTCGIENHESINNIK
KSIVSAFFTNAALPVNKTELKIIKLNQVVSIYPNSVLFKKNIMEENENVCIIFYEVIKLN
KSYIRHNIPVNKNLLFQIADFYFLNKTE
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaaagtgatttacataagagatcaattgaatttaccgataatgatgaatca
aaaaaaaaaataaaaacagacggagaagaaaatgatataatggaaagtaaaggaaaagat
tcttattctttatatttagaatatcaaaaaggtaggaataaaaaattaaagaataatgaa
gaatacattgaatatttaaaaaaagatgctaggagaaaatatttaaaagaaagagaaaaa
gaaaaattagatataacgaagaaattattagatgatgaattattatatagtactgtaaaa
ttagaaggaaaagatttaaaagaattacagttttctaaaaaaatatataatatagcaaaa
gaaaatataaatctaagagaaaaattacaagaagaatcatattattttcaacaagatata
gataaaaataaaaaaacacaaacatatgaaaacgacaaagtagataaatcattatataat
tatgatgaacaaattttaaataaaggaatactcaaatttggttctgcaatttcaaaacaa
aatatacaaaaacaaaataataatgaatttgtttttgacgacgatattattacaactaat
agaaaaagtataaaaagggaatcctttgaagagaaaaaaatgaatgagtcaccaacaaaa
aaaaaaaaaaaaagaaaagatgacatagaaagtgataataagtgtgataaggatgaaaaa
tatgataagtatggtaaattctataaacgtgataaacaccataaatacgataaacacgat
aaacacgataaatacgataaacacgataaacacgataaacatgataaacatgacaaacac
gataaacacgataaacacgataaaaatgacaaacacgataaacacgataaacacgataaa
catgacaaacataataaaaaataccattctaaatataaagaattaaatacctcttatgat
aacaatagtcccaccgatagtacttataaaagtgaagaggaaagctcctcatcaggggat
aaaaatcatagaaacaataaatatgatagtgacaaaataaaacatgaaaaaaaaaaaaaa
aaaaagagtataatgactgatgaagaaagaaatgttgatagtaataagagatcctttgaa
aaaaaggaatccgaattaaatgaaaatggacttacggatgttgttgaatttgtacattta
gaaagtttttatggtatgaatgaaaaagaaaaagaattagaaaaactttttgaagatata
aaaaaaagaaaagaaaagaaaatgaaaaaaattattgatgaaaggaaaaggttacctata
tatagttatagatatgatatattgaaagctataaaaaataataaaattttaatattagta
ggtgaaacaggtagtggaaaaagtacacaattaactcaatatttatatgaatgtaaatat
catatgtatggtaatattatttgtactcaaccaagaagaattgcatgtatagctatagca
aatagggtagcagaagaaatgaatgtaaaaataggtaaagaagttggatatgtaattaga
tttcaaaataaaacaagtgaagctaccaaaattatgtatatgacagatggtatgttttta
cgtctgttattatataatccaacattagaagatatatctgtattaattattgatgaagca
catgaaagagctttacacacagatgttattttgcccatagtaaaagatatatgtaacttt
agagaaaatattagagttgttatatcttcagctactttagatgcagaaaaaatatcgact
tactttaattgtgcacccattttttatgtaccaggaagaaaatataatgtagatatatac
tatacaataaataatgaaagtaattatatatcagccattgtaataactatattacaaata
catataactcaaggaaaaggagatattttagtatttttaccaggccaatatgaaattgaa
ttagtacaacaggaactagaaaataaattaaatgagctggctccaaaatatcgtaatctg
gtcatattacctatttattcctctttgcctgtagaatatcaggcacgtatatttgaagat
gttactgaagaagacaatatgaagtttttagaagatattaatgataagaaggatgaaagg
aataaaaaccataaagatgatgaaaatgatgaaaatggtgaaaatgaaaaaaatgataaa
aatgaaaaaaatgataaaaatgataaaaattataaaaatgaaaaaaatgaaaaaaataat
gataaaaatgataaaaataatgtaggtaataattccaaaatgaatgtgtcacaaagtaag
aataaaagaaatattaacgaagaaatagaagaacttaaaagaataaatacgaataataaa
ataagaaggaaaattattttatcaacaaatatttgtgaaacgagtataactatagacaat
attgtatatgttattgattcaggtttatgtaaacaaaaaatatataacccgaattcaggt
atagaatctttagttactctaccatgttctaaagcatcagtgaatcaaaggacaggtaga
gcaggaagaaaaagagatgggaaatgttttcgattatttacaaaaaaatcatttattgat
ttaagtgataattcaattcctgaaatacaaagatgtgaaattagtagtatgatattgtta
ttaaaaagtttaggtatggatgatattattaattttgattttttagatcctccttctcca
attgttattattaaaggattagaacttttatattctttaggtgctttaaatgatgaagga
aatttgactaggacaggacgcaaaatggcagaatttccaacagatgtaaaatcaagtaaa
atgattttatccgctgcagaaaaatataattgtgttgatgaaatattaaatgttgcatcc
atgttaacacatgctaataatattttttatgttcaaaagggtaaagaaaaagaagcagaa
aatattaaaaaaatgtttattattgaaggtggaggtgatttcttactctttttaaatatt
tacaaacaatgtgaagaaaataatttctctacctccttttgttatgatcattttttacaa
tatcatacacttattaaagttaaagatgtaaaaacacaactattaagtatatgtgaaaaa
attgatatacccattacaacttgtggtattgaaaatcatgaatccataaataatattaaa
aaaagtattgtcagtgcattttttactaatgctgctttacctgttaataaaactgaactc
aaaattataaaattaaatcaagttgttagtatatatcctaattctgttctctttaaaaaa
aatattatggaggaaaatgaaaatgtgtgtatcattttttatgaagttattaaactaaat
aaatcatatatacgacataatatacctgtaaataagaacctgttatttcaaattgcagac
ttttattttcttaataaaacggaataa

DBGET integrated database retrieval system