KEGG   Plasmodium falciparum 3D7: PFL1940wHelp
Entry
PFL1940w          CDS       T00095                                 

Definition
3-hydroxyisobutyryl-coenzyme A hydrolase, putative (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFL1940w
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PFL1940w
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFL1940w
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFL1940w
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PFL1940w
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
12:1682824..1684449
Genome map
AA seq 541 aa AA seqDB search
MLKFNCIPYKNIGTFHDALKQHNIKFEKRNNFIFFHAFSSLRKYKSQHSEKNNILNKLFF
FKKEYKSYFHKLSNNLFLSSKRKNEVIFHKMDKTNKNVQMIKHNIITSQRRENGMEQYTA
IDGKTKVNNNNNNDNSNNNNDNSNNNKNNNNDMKANIHHDMDKVKNNMIDLELSELWTKK
SLIVNFQNNICEIILNRPEKLNAINKDMINALLNIIKSLDNDERCFMVIIRSTNSNCFSS
GSDVKYVVENKEQGIQHLKQLYLYINYISQMKKNLLCIWNGYVMGGGLGISIYSKYKVIN
KNAIFAMPENKIGFFPDIGCCYFFRKYFGRNIGLHLGLTSLRLNEVDLINFNVCNNYIEN
VDTFMDNLNNIKATNQEDFNKKLNNLLTNKYVSKMSYNKSNNPVLTDELINNINTYYSSA
NTLEDLITKLKKDNNDFCKKLLSDIYSNCYFSCMFWFSYYLYNYEKSLEEVLNNDFKITQ
YFLFHKNSFERGVTEVLVKKNKNFQWSKDEETNNADFEDIDDILMNKNLLSIKEEFTNMS
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtttaattgcataccttataaaaatataggaacctttcatgatgcccttaag
cagcataatataaaatttgaaaaaagaaacaattttattttttttcatgctttttcatct
ttacgtaaatataaatcacaacattctgaaaagaataatattttgaataaattatttttt
tttaaaaaagaatacaaaagttacttccacaaactttccaataatttgttcttgtctagt
aagagaaaaaatgaagtaatatttcataaaatggataagacgaataaaaatgttcaaatg
attaaacataatattataactagccaaagaagagaaaatgggatggaacaatatactgct
atagatggtaaaaccaaagtaaacaacaacaataataatgataatagtaataacaataat
gataatagtaataacaataaaaataataataatgatatgaaagcaaatattcatcatgat
atggataaagtaaaaaataatatgatcgatttagaactatcagaattatggactaaaaaa
tcattaattgttaattttcaaaataatatatgtgaaataattttaaataggcccgaaaaa
ttaaatgcaataaataaggatatgataaatgcattattaaatataataaaaagtttagat
aatgatgaaagatgttttatggtaataattcgaagtactaacagcaactgtttttcatca
ggctcagatgtaaaatatgttgttgaaaataaagaacaaggtatacaacatttaaaacag
ctatatttgtatattaattatatatcccaaatgaaaaaaaatttactatgtatatggaat
ggatatgttatgggaggtggtctaggaatttctatttattcaaaatataaagtaataaat
aaaaacgctatatttgccatgcctgaaaataaaataggttttttccctgatattggatgt
tgttattttttcagaaaatattttggaagaaatataggtttacatttaggtttaacatca
ttaagattaaatgaggtggatttgattaattttaatgtgtgtaataattatattgaaaat
gttgatacttttatggataatttgaataatataaaagcaacaaatcaagaagatttcaat
aagaaattaaataatttattaacaaataaatatgtttcaaaaatgtcttataataagtct
aataatccagtcttaacagatgagttaattaataatattaatacatattatagtagtgca
aataccttggaagatttaataaccaaattaaaaaaagataacaacgatttctgtaaaaag
ttattatctgatatttattctaattgctattttagttgtatgttctggttttcttattat
ttatataattatgaaaaatcattagaagaggtattaaataatgatttcaaaattactcaa
tattttctgtttcataaaaattcttttgaaaggggtgtaacagaagtattggtgaaaaaa
aataaaaactttcaatggagcaaagacgaagaaacaaataatgccgactttgaagatatt
gacgatattttgatgaacaaaaatttgttgtcaataaaggaagagtttacaaatatgagt
gaataa

DBGET integrated database retrieval system