KEGG   Plasmodium falciparum 3D7: PFL1940wHelp
Entry
PFL1940w          CDS       T00095                                 

Definition
3-hydroxyisobutyryl-coenzyme A hydrolase, putative (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfa01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pfa00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pfa00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pfa00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
12:1682824..1684449
Genome map
AA seq 541 aa AA seqDB search
MLKFNCIPYKNIGTFHDALKQHNIKFEKRNNFIFFHAFSSLRKYKSQHSEKNNILNKLFF
FKKEYKSYFHKLSNNLFLSSKRKNEVIFHKMDKTNKNVQMIKHNIITSQRRENGMEQYTA
IDGKTKVNNNNNNDNSNNNNDNSNNNKNNNNDMKANIHHDMDKVKNNMIDLELSELWTKK
SLIVNFQNNICEIILNRPEKLNAINKDMINALLNIIKSLDNDERCFMVIIRSTNSNCFSS
GSDVKYVVENKEQGIQHLKQLYLYINYISQMKKNLLCIWNGYVMGGGLGISIYSKYKVIN
KNAIFAMPENKIGFFPDIGCCYFFRKYFGRNIGLHLGLTSLRLNEVDLINFNVCNNYIEN
VDTFMDNLNNIKATNQEDFNKKLNNLLTNKYVSKMSYNKSNNPVLTDELINNINTYYSSA
NTLEDLITKLKKDNNDFCKKLLSDIYSNCYFSCMFWFSYYLYNYEKSLEEVLNNDFKITQ
YFLFHKNSFERGVTEVLVKKNKNFQWSKDEETNNADFEDIDDILMNKNLLSIKEEFTNMS
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtttaattgcataccttataaaaatataggaacctttcatgatgcccttaag
cagcataatataaaatttgaaaaaagaaacaattttattttttttcatgctttttcatct
ttacgtaaatataaatcacaacattctgaaaagaataatattttgaataaattatttttt
tttaaaaaagaatacaaaagttacttccacaaactttccaataatttgttcttgtctagt
aagagaaaaaatgaagtaatatttcataaaatggataagacgaataaaaatgttcaaatg
attaaacataatattataactagccaaagaagagaaaatgggatggaacaatatactgct
atagatggtaaaaccaaagtaaacaacaacaataataatgataatagtaataacaataat
gataatagtaataacaataaaaataataataatgatatgaaagcaaatattcatcatgat
atggataaagtaaaaaataatatgatcgatttagaactatcagaattatggactaaaaaa
tcattaattgttaattttcaaaataatatatgtgaaataattttaaataggcccgaaaaa
ttaaatgcaataaataaggatatgataaatgcattattaaatataataaaaagtttagat
aatgatgaaagatgttttatggtaataattcgaagtactaacagcaactgtttttcatca
ggctcagatgtaaaatatgttgttgaaaataaagaacaaggtatacaacatttaaaacag
ctatatttgtatattaattatatatcccaaatgaaaaaaaatttactatgtatatggaat
ggatatgttatgggaggtggtctaggaatttctatttattcaaaatataaagtaataaat
aaaaacgctatatttgccatgcctgaaaataaaataggttttttccctgatattggatgt
tgttattttttcagaaaatattttggaagaaatataggtttacatttaggtttaacatca
ttaagattaaatgaggtggatttgattaattttaatgtgtgtaataattatattgaaaat
gttgatacttttatggataatttgaataatataaaagcaacaaatcaagaagatttcaat
aagaaattaaataatttattaacaaataaatatgtttcaaaaatgtcttataataagtct
aataatccagtcttaacagatgagttaattaataatattaatacatattatagtagtgca
aataccttggaagatttaataaccaaattaaaaaaagataacaacgatttctgtaaaaag
ttattatctgatatttattctaattgctattttagttgtatgttctggttttcttattat
ttatataattatgaaaaatcattagaagaggtattaaataatgatttcaaaattactcaa
tattttctgtttcataaaaattcttttgaaaggggtgtaacagaagtattggtgaaaaaa
aataaaaactttcaatggagcaaagacgaagaaacaaataatgccgactttgaagatatt
gacgatattttgatgaacaaaaatttgttgtcaataaaggaagagtttacaaatatgagt
gaataa

DBGET integrated database retrieval system