
Database: Pfam
Entry: AdoHcyase_NAD
LinkDB: AdoHcyase_NAD
Original site: AdoHcyase_NAD 
#=GF ID   AdoHcyase_NAD
#=GF AC   PF00670.16
#=GF DE   S-adenosyl-L-homocysteine hydrolase, NAD binding domain
#=GF PI   AdoHcyase; 
#=GF AU   Bateman A, Griffiths-Jones SR, Finn RD
#=GF SE   Pfam-B_157 (release 2.1)
#=GF GA   21.70 21.70;
#=GF TC   21.70 21.70;
#=GF NC   21.60 21.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   S-adenosyl-L-homocysteine_hydrolase
#=GF DR   INTERPRO; IPR015878;
#=GF DR   SCOP; 1b3r; fa;
#=GF SQ   2557
#=GS D0SWS3_ACILW/197-372  AC D0SWS3.1
#=GS F4F6A8_VERMA/257-419  AC F4F6A8.1
#=GS E4YV13_OIKDI/193-267  AC E4YV13.1
#=GS B6JBB2_OLICO/231-390  AC B6JBB2.1
#=GS H0X9M4_OTOGA/289-450  AC H0X9M4.1
#=GS H0HKT9_9RHIZ/226-385  AC H0HKT9.1
#=GS E0I3E5_9BACL/190-351  AC E0I3E5.1
#=GS F7YX09_9THEM/174-335  AC F7YX09.1
#=GS D5WSA8_BACT2/188-348  AC D5WSA8.1
#=GS G2P959_STRVO/168-324  AC G2P959.1
#=GS Q80TQ9_MOUSE/237-398  AC Q80TQ9.1
#=GS E4W1B4_BACFG/232-394  AC E4W1B4.1
#=GS A4CIU7_ROBBH/197-358  AC A4CIU7.1
#=GS G1QTF9_NOMLE/289-450  AC G1QTF9.1
#=GS A5E357_LODEL/191-352  AC A5E357.1
#=GS C5LXA1_PERM5/232-396  AC C5LXA1.1
#=GS G8F3A9_MACFA/289-450  AC G8F3A9.1
#=GS B4EE70_BURCJ/233-392  AC B4EE70.1
#=GS A5IDK4_LEGPC/202-361  AC A5IDK4.1
#=GS SAHH_POLSQ/235-399    AC A4T0E9.1
#=GS D3PEF1_DEFDS/185-347  AC D3PEF1.1
#=GS E1LAM8_9FIRM/184-345  AC E1LAM8.1
#=GS SAHHB_XENLA/192-353   AC O93477.1
#=GS A1L1P3_DANRE/256-417  AC A1L1P3.1
#=GS H8GMC4_METAL/190-349  AC H8GMC4.1
#=GS Q5D6C5_ARATH/240-403  AC Q5D6C5.1
#=GS A0JCJ9_PLUXY/190-350  AC A0JCJ9.1
#=GS F8JPG0_STREN/247-409  AC F8JPG0.1
#=GS C4Y0X4_CLAL4/240-401  AC C4Y0X4.1
#=GS A3DN18_STAMF/185-347  AC A3DN18.1
#=GS SAHH_BRUC2/227-386    AC A9M9T1.1
#=GS A6EPZ2_9BACT/197-356  AC A6EPZ2.1
#=GS A3KAZ8_9RHOB/223-382  AC A3KAZ8.1
#=GS D5EF23_AMICL/184-345  AC D5EF23.1
#=GS A5D1G7_PELTS/185-346  AC A5D1G7.1
#=GS B4SJZ9_STRM5/239-401  AC B4SJZ9.1
#=GS G3A3E3_9RALS/231-390  AC G3A3E3.1
#=GS H3BKT5_MOUSE/163-324  AC H3BKT5.1
#=GS D5QIU6_GLUHA/190-349  AC D5QIU6.1
#=GS SAHH_PSEU5/199-380    AC A4VRF7.1
#=GS A0KIP4_AERHH/167-321  AC A0KIP4.1
#=GS G3BD48_CANTC/138-299  AC G3BD48.1
#=GS A5J5D7_BURML/235-394  AC A5J5D7.1
#=GS Q5X3C6_LEGPA/155-279  AC Q5X3C6.1
#=GS E6S782_INTC7/236-398  AC E6S782.1
#=GS G2HB55_9DELT/238-400  AC G2HB55.1
#=GS D1R6Y3_9CHLA/201-364  AC D1R6Y3.1
#=GS Q3Z942_DEHE1/185-346  AC Q3Z942.1
#=GS E7H0S9_9BURK/226-385  AC E7H0S9.1
#=GS E0SP38_IGNAA/184-345  AC E0SP38.1
#=GS D7G8Q4_ECTSI/236-396  AC D7G8Q4.1
#=GS B7K2I6_CYAP8/192-353  AC B7K2I6.1
#=GS H8E1L4_9MICO/246-413  AC H8E1L4.1
#=GS SAHH_PSEE4/199-381    AC Q1I3W5.1
#=GS G7CNC6_MYCTH/247-408  AC G7CNC6.1
#=GS G4M0M5_SCHMA/330-491  AC G4M0M5.1
#=GS SAHH_PIG/191-352      AC Q710C4.3
#=GS B3KUN3_HUMAN/163-324  AC B3KUN3.1
#=GS D1AF40_THECD/186-348  AC D1AF40.1
#=GS G5H1D9_9FIRM/184-345  AC G5H1D9.1
#=GS I0LHG2_CORGL/236-398  AC I0LHG2.1
#=GS A7HPA7_PARL1/233-392  AC A7HPA7.1
#=GS C3NEA9_SULIY/209-370  AC C3NEA9.1
#=GS C9VJA1_9RHIZ/227-386  AC C9VJA1.1
#=GS B0MW70_9BACT/234-395  AC B0MW70.1
#=GS G8UIE4_TANFA/232-394  AC G8UIE4.1
#=GS Q1AZH2_RUBXD/191-352  AC Q1AZH2.1
#=GS Q1K322_DESAC/231-393  AC Q1K322.1
#=GS F8JAK1_HYPSM/230-389  AC F8JAK1.1
#=GS C7R5W3_KANKD/150-277  AC C7R5W3.1
#=GS A6FUY1_9RHOB/222-381  AC A6FUY1.1
#=GS C8WGD8_EGGLE/185-346  AC C8WGD8.1
#=GS G7TDT7_9XANT/238-400  AC G7TDT7.1
#=GS SAHH1_ARATH/240-403   AC O23255.1
#=GS C7DEZ5_9RHOB/223-382  AC C7DEZ5.1
#=GS H2H475_CORDP/236-398  AC H2H475.1
#=GS H9F9K2_MACMU/303-464  AC H9F9K2.1
#=GS H0YRF3_TAEGU/251-412  AC H0YRF3.1
#=GS Q6KZJ7_PICTO/175-336  AC Q6KZJ7.1
#=GS H0VJK0_CAVPO/289-450  AC H0VJK0.1
#=GS E2VD69_MYCTU/253-415  AC E2VD69.1
#=GS E6ZM83_SPORE/188-349  AC E6ZM83.1
#=GS F0GLY3_9LACO/182-330  AC F0GLY3.1
#=GS H2Z7I9_CIOSA/358-472  AC H2Z7I9.1
#=GS D7IX58_9BACE/232-394  AC D7IX58.1
#=GS I1RNN2_GIBZE/194-323  AC I1RNN2.1
#=GS SAHH_ROSDO/223-382    AC Q9ZNA5.1
#=GS A3Z465_9SYNE/237-396  AC A3Z465.1
#=GS SAHH_CORGB/236-398    AC A4QC87.1
#=GS F9UZB5_MYCBO/253-415  AC F9UZB5.1
#=GS D5C3N6_NITHN/188-349  AC D5C3N6.1
#=GS F6TZT1_CALJA/191-352  AC F6TZT1.1
#=GS G7DPR7_BRAJP/232-391  AC G7DPR7.1
#=GS C2FX30_9SPHI/197-358  AC C2FX30.1
#=GS Q4C723_CROWT/192-353  AC Q4C723.1
#=GS C7YYH5_NECH7/194-355  AC C7YYH5.1
#=GS H7EV54_PSEST/199-380  AC H7EV54.1
#=GS H2TA79_TAKRU/269-430  AC H2TA79.1
#=GS SAHH_HERAR/240-399    AC A4G975.1
#=GS D9W3C2_9ACTO/239-401  AC D9W3C2.1
#=GS G7Z7L3_AZOL4/193-352  AC G7Z7L3.1
#=GS H8WE52_MARHY/200-376  AC H8WE52.1
#=GS F9X1E9_MYCGM/198-359  AC F9X1E9.1
#=GS A8QBB7_BRUMA/165-326  AC A8QBB7.1
#=GS B4G0V3_MAIZE/194-354  AC B4G0V3.1
#=GS A0ZN77_NODSP/192-311  AC A0ZN77.1
#=GS C6W7Z5_ACTMD/249-411  AC C6W7Z5.1
#=GS F9Z3R2_ODOSD/361-516  AC F9Z3R2.1
#=GS A8U0F7_9PROT/192-351  AC A8U0F7.1
#=GS C5KQ92_PERM5/1-67     AC C5KQ92.1
#=GS SAHH_BURMA/234-393    AC Q62G22.1
#=GS Q83X57_STRRO/234-396  AC Q83X57.1
#=GS F8QXI7_9EUCA/27-85    AC F8QXI7.1
#=GS A8L9A5_FRASN/173-327  AC A8L9A5.1
#=GS G1MTG4_MELGA/197-358  AC G1MTG4.1
#=GS I1DHP5_9VIBR/187-349  AC I1DHP5.1
#=GS Q0UM97_PHANO/194-355  AC Q0UM97.1
#=GS Q07IV6_RHOP5/235-394  AC Q07IV6.1
#=GS C0VJY4_9GAMM/197-372  AC C0VJY4.1
#=GS Q0S2Y7_RHOSR/252-414  AC Q0S2Y7.1
#=GS G3NYP4_GASAC/314-475  AC G3NYP4.1
#=GS D2BEM4_STRRD/233-395  AC D2BEM4.1
#=GS SAHH_PYRAE/205-367    AC Q8ZTQ7.1
#=GS Q2C474_9GAMM/205-347  AC Q2C474.1
#=GS F0V187_9VIBR/171-332  AC F0V187.1
#=GS A5P6T9_9SPHN/230-389  AC A5P6T9.1
#=GS E2PR18_9RHIZ/227-386  AC E2PR18.1
#=GS G4T616_PIRID/189-350  AC G4T616.1
#=GS Q4RHJ7_TETNG/268-305  AC Q4RHJ7.1
#=GS F4QY15_BREDI/224-383  AC F4QY15.1
#=GS SAHH_JANMA/240-399    AC A6T2Y9.1
#=GS H1JDM6_9FIRM/200-361  AC H1JDM6.1
#=GS F4W8K2_ACREC/192-352  AC F4W8K2.1
#=GS SAHH_BURM7/234-393    AC A3MQW7.1
#=GS B9KRF4_RHOSK/231-390  AC B9KRF4.1
#=GS G2Q751_THIHA/194-355  AC G2Q751.1
#=GS E5C8J7_9BACE/232-394  AC E5C8J7.2
#=GS H5SVQ4_9BACT/184-345  AC H5SVQ4.1
#=GS B6R273_9RHOB/236-395  AC B6R273.1
#=GS G1LRB0_AILME/191-352  AC G1LRB0.1
#=GS H3NUU4_9GAMM/199-375  AC H3NUU4.1
#=GS C6J396_9BACL/190-351  AC C6J396.1
#=GS D2PMF6_KRIFD/236-398  AC D2PMF6.1
#=GS E1IG03_9CHLR/187-348  AC E1IG03.1
#=GS E2UQS3_MYCTU/253-415  AC E2UQS3.1
#=GS A7TZB1_9MAXI/192-353  AC A7TZB1.1
#=GS A6UYP2_PSEA7/195-377  AC A6UYP2.1
#=GS G4PII5_BRUML/227-386  AC G4PII5.1
#=GS G2DER9_9GAMM/1-64     AC G2DER9.1
#=GS G0V1L6_TRYCI/190-351  AC G0V1L6.1
#=GS H0P5K6_9SYNC/192-353  AC H0P5K6.1
#=GS E9FR15_DAPPU/191-352  AC E9FR15.1
#=GS H1XF44_9XANT/238-400  AC H1XF44.1
#=GS G1MTN3_MELGA/250-411  AC G1MTN3.2
#=GS H1CL04_9FIRM/183-344  AC H1CL04.1
#=GS A5CPS8_CLAM3/252-414  AC A5CPS8.1
#=GS H8EAK3_CLOTM/184-345  AC H8EAK3.1
#=GS I0KGL9_9BACT/195-356  AC I0KGL9.1
#=GS A5Z4P4_9FIRM/110-242  AC A5Z4P4.1
#=GS F6VIG9_HORSE/191-352  AC F6VIG9.1
#=GS E6SK69_THEM7/191-352  AC E6SK69.1
#=GS H2Z7I9_CIOSA/285-351  AC H2Z7I9.1
#=GS C3R0P3_9BACE/236-398  AC C3R0P3.1
#=GS D7IZI2_9BACE/236-398  AC D7IZI2.1
#=GS Q0RR77_FRAAA/207-369  AC Q0RR77.1
#=GS G4QWS0_CORPS/237-399  AC G4QWS0.1
#=GS F9WIR5_TRYCI/190-351  AC F9WIR5.1
#=GS F0JE79_DESDE/236-398  AC F0JE79.1
#=GS F6EZF2_SPHCR/230-389  AC F6EZF2.1
#=GS F5LLX9_9BACL/136-263  AC F5LLX9.1
#=GS A6QLP2_BOVIN/370-531  AC A6QLP2.1
#=GS C6X3N4_FLAB3/212-373  AC C6X3N4.1
#=GS SAHH_PYRKO/188-349    AC Q5JED2.1
#=GS F9DP61_9BACL/108-194  AC F9DP61.1
#=GS Q221A0_RHOFD/241-405  AC Q221A0.1
#=GS F2K652_PSEBN/199-381  AC F2K652.1
#=GS F5T186_9GAMM/197-356  AC F5T186.1
#=GS F1A3B7_DICPU/191-351  AC F1A3B7.1
#=GS E7Q2V9_YEASB/194-355  AC E7Q2V9.1
#=GS G3SFV2_GORGO/186-346  AC G3SFV2.1
#=GS E8R782_DESM0/184-346  AC E8R782.1
#=GS C5JTS9_AJEDS/194-355  AC C5JTS9.1
#=GS Q26HI6_FLABB/197-358  AC Q26HI6.1
#=GS SAHH_MYCTU/253-415    AC P60176.2
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ1 C; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ1 A; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3DHY B; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZIZ C; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3DHY D; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZIZ A; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ1 B; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ0 D; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZIZ B; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3CE6 B; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3CE6 C; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3DHY A; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ0 B; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZIZ D; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ0 A; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ1 D; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3CE6 A; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3CE6 D; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 2ZJ0 C; 253-415;
#=GS SAHH_MYCTU/253-415    DR PDB; 3DHY C; 253-415;
#=GS Q1HDX9_MUSAC/1-85     AC Q1HDX9.1
#=GS G7QA66_9DELT/234-396  AC G7QA66.1
#=GS D9ZCK0_9CARY/1-123    AC D9ZCK0.1
#=GS C9KKZ6_9FIRM/184-345  AC C9KKZ6.1
#=GS G7QY38_MYCBO/253-415  AC G7QY38.1
#=GS F3L3H4_9GAMM/199-375  AC F3L3H4.1
#=GS SAHH_PETCR/240-403    AC Q01781.2
#=GS G2UTS5_MYCTU/253-415  AC G2UTS5.1
#=GS D3NY11_AZOS1/193-352  AC D3NY11.1
#=GS F7WQL9_MYCTD/253-415  AC F7WQL9.1
#=GS B4RBP7_PHEZH/224-383  AC B4RBP7.1
#=GS D3SV14_NATMM/192-353  AC D3SV14.1
#=GS SAHH_METPP/237-396    AC A2SL00.1
#=GS E6Q5G3_9ZZZZ/160-321  AC E6Q5G3.1
#=GS D7DA28_STAHD/185-347  AC D7DA28.1
#=GS A4WLG3_PYRAR/205-367  AC A4WLG3.1
#=GS E6UGZ2_RUMA7/112-239  AC E6UGZ2.1
#=GS E6V799_VARPE/239-398  AC E6V799.1
#=GS C9VCS9_BRUNE/227-386  AC C9VCS9.1
#=GS G8VZN8_KLEPN/177-326  AC G8VZN8.1
#=GS Q1AUI3_RUBXD/186-347  AC Q1AUI3.1
#=GS E8MSB4_BIFL1/261-420  AC E8MSB4.1
#=GS F1S613_PIG/257-420    AC F1S613.1
#=GS G4M5A2_9BURK/235-394  AC G4M5A2.1
#=GS SAHH_BORBR/232-391    AC Q7WQX5.1
#=GS D2PC37_SULID/160-321  AC D2PC37.1
#=GS G2I6W6_GLUXN/192-351  AC G2I6W6.1
#=GS SAHH_PSEAE/199-381    AC Q9I685.1
#=GS E4NC13_KITSK/240-402  AC E4NC13.1
#=GS H0C4L5_9BURK/237-397  AC H0C4L5.1
#=GS B6AQP5_9BACT/185-346  AC B6AQP5.1
#=GS B1HA73_BURPE/234-393  AC B1HA73.1
#=GS D9U9W4_CAEFU/7-24     AC D9U9W4.1
#=GS F6RAQ5_CALJA/268-429  AC F6RAQ5.1
#=GS F3KJK9_9ARCH/160-321  AC F3KJK9.1
#=GS E8W4B2_STRFA/243-405  AC E8W4B2.1
#=GS F3M641_9BACL/190-351  AC F3M641.1
#=GS E6N5I6_9ARCH/125-286  AC E6N5I6.1
#=GS A2D9T1_TRIVA/1-69     AC A2D9T1.1
#=GS C4R5W1_PICPG/190-351  AC C4R5W1.1
#=GS G4EBA3_9BACL/188-349  AC G4EBA3.1
#=GS F7I7D1_CALJA/254-415  AC F7I7D1.1
#=GS B5DGE0_SALSA/192-353  AC B5DGE0.1
#=GS B0SU34_LEPBP/199-361  AC B0SU34.1
#=GS F4RXA0_MELLP/189-350  AC F4RXA0.1
#=GS F0QLL2_ACIBD/197-372  AC F0QLL2.1
#=GS F3HD51_PSEYM/199-381  AC F3HD51.1
#=GS I0A1B3_9CREN/185-346  AC I0A1B3.1
#=GS F8ARX4_BIFLN/261-420  AC F8ARX4.1
#=GS G4LX02_SCHMA/65-226   AC G4LX02.1
#=GS SAHH_SCHPO/192-353    AC O13639.1
#=GS F0NF41_SULIR/203-364  AC F0NF41.1
#=GS H1CYV0_9FIRM/185-346  AC H1CYV0.1
#=GS F1W7Z6_MORCA/208-381  AC F1W7Z6.1
#=GS D3ZQH8_RAT/189-331    AC D3ZQH8.1
#=GS A8LP94_DINSH/223-382  AC A8LP94.1
#=GS SAHH_LEPCP/237-396    AC B1Y647.1
#=GS B4NJG0_DROWI/252-413  AC B4NJG0.1
#=GS H1Q975_9ACTO/243-405  AC H1Q975.1
#=GS C6X8F7_METSD/230-389  AC C6X8F7.1
#=GS B6WV15_9DELT/253-415  AC B6WV15.1
#=GS C7Q1P5_CATAD/244-406  AC C7Q1P5.1
#=GS C5FU41_ARTOC/194-355  AC C5FU41.1
#=GS E6RCY7_CRYGW/190-351  AC E6RCY7.1
#=GS H0TU86_9BRAD/229-388  AC H0TU86.1
#=GS SAHH_RALME/231-390    AC Q1LS20.1
#=GS F2N678_PSEU6/199-380  AC F2N678.1
#=GS E0RHA2_PAEP6/190-351  AC E0RHA2.1
#=GS D0IYP5_COMT2/236-395  AC D0IYP5.1
#=GS E4PN47_MARAH/200-376  AC E4PN47.1
#=GS A1AX10_RUTMC/206-382  AC A1AX10.1
#=GS G0L3R1_ZOBGA/197-358  AC G0L3R1.1
#=GS D6B3H9_9ACTO/242-404  AC D6B3H9.1
#=GS SAHH_CHLTE/231-393    AC Q8KEG8.1
#=GS B4M6U8_DROVI/191-352  AC B4M6U8.1
#=GS SAHH_NOSS1/192-353    AC Q8YX05.1
#=GS D9VYW2_9ACTO/236-398  AC D9VYW2.1
#=GS F8E7L7_FLESM/228-390  AC F8E7L7.1
#=GS SAHH_XANCP/238-400    AC Q8PCH5.1
#=GS H6CKH6_9BACL/190-351  AC H6CKH6.1
#=GS H9JJV7_BOMMO/250-421  AC H9JJV7.1
#=GS E6YNV7_9RHIZ/226-385  AC E6YNV7.1
#=GS Q4S7H8_TETNG/246-420  AC Q4S7H8.1
#=GS D3S0P2_FERPA/177-337  AC D3S0P2.1
#=GS E0VEP6_PEDHC/170-331  AC E0VEP6.1
#=GS H8X940_9ASCO/194-355  AC H8X940.1
#=GS G0V1L3_TRYCI/1-63     AC G0V1L3.1
#=GS D1RKF0_LEGLO/202-361  AC D1RKF0.1
#=GS B8G9P9_CHLAD/187-348  AC B8G9P9.1
#=GS A7BAZ9_9ACTO/268-435  AC A7BAZ9.1
#=GS I0GZA3_ACTMI/240-402  AC I0GZA3.1
#=GS E9BUB8_LEIDB/190-351  AC E9BUB8.1
#=GS I0G426_9BRAD/232-391  AC I0G426.1
#=GS D1N9A3_9BACT/225-390  AC D1N9A3.1
#=GS B0MNU3_9FIRM/183-344  AC B0MNU3.1
#=GS G4G176_9GAMM/237-399  AC G4G176.1
#=GS G5DYL0_9PIPI/178-317  AC G5DYL0.1
#=GS F7Y1R7_MESOW/227-386  AC F7Y1R7.1
#=GS F1XEP6_MORCA/208-381  AC F1XEP6.1
#=GS SAHH_METMP/183-343    AC Q6LYR8.1
#=GS B0E758_ENTDS/226-388  AC B0E758.1
#=GS D2MI68_9BACT/202-378  AC D2MI68.1
#=GS F5LV58_GARVA/263-419  AC F5LV58.1
#=GS D9ZCI0_9CARY/1-123    AC D9ZCI0.1
#=GS C8WRY5_ALIAD/188-349  AC C8WRY5.1
#=GS B3NEZ6_DROER/280-441  AC B3NEZ6.1
#=GS H5XTT5_9FIRM/186-347  AC H5XTT5.1
#=GS D9ZCK1_9CARY/1-123    AC D9ZCK1.1
#=GS B1JTJ4_BURCC/233-392  AC B1JTJ4.1
#=GS SAHH_BORPA/232-391    AC Q7W1Z7.1
#=GS SAHH_NICSY/240-403    AC P68172.1
#=GS Q0FE41_9RHOB/224-383  AC Q0FE41.1
#=GS C7QMQ8_CYAP0/192-353  AC C7QMQ8.1
#=GS G6GEX9_9FIRM/188-349  AC G6GEX9.1
#=GS SAHH2_DROME/252-413   AC P50245.2
#=GS C8NLT6_COREF/236-398  AC C8NLT6.1
#=GS H2YAU9_CIOSA/192-373  AC H2YAU9.1
#=GS B8I477_CLOCE/184-345  AC B8I477.1
#=GS SAHH_XANOP/238-400    AC B2SPN6.1
#=GS E5X6A3_9ACTN/185-346  AC E5X6A3.1
#=GS D7E778_METEZ/227-389  AC D7E778.1
#=GS SAHH_PHASS/240-403    AC P50249.1
#=GS Q1PUP9_9BACT/203-379  AC Q1PUP9.1
#=GS SAHH_PROM9/233-392    AC Q318B6.1
#=GS SAHH_BARQU/226-385    AC Q6G1D6.1
#=GS G2YBK9_BOTF4/194-355  AC G2YBK9.1
#=GS A0BCF6_PARTE/233-395  AC A0BCF6.1
#=GS SAHH_BURP1/234-393    AC Q3JY79.1
#=GS SAHH_BURP1/234-393    DR PDB; 3GLQ B; 234-393;
#=GS SAHH_BURP1/234-393    DR PDB; 3D64 A; 234-393;
#=GS SAHH_BURP1/234-393    DR PDB; 3GLQ A; 234-393;
#=GS SAHH_BURP1/234-393    DR PDB; 3D64 B; 234-393;
#=GS Q2S3G6_SALRD/189-350  AC Q2S3G6.1
#=GS A6LNV3_THEM4/171-331  AC A6LNV3.1
#=GS Q4DNQ7_TRYCC/190-351  AC Q4DNQ7.1
#=GS A5UL54_METS3/183-344  AC A5UL54.1
#=GS A8PCR9_COPC7/189-350  AC A8PCR9.2
#=GS Q4SUC9_TETNG/198-358  AC Q4SUC9.1
#=GS F9QRR7_9MYCO/248-410  AC F9QRR7.1
#=GS E2SDU6_9ACTO/241-403  AC E2SDU6.1
#=GS A9UTL4_MONBE/191-352  AC A9UTL4.1
#=GS E1ARJ4_STRAU/236-398  AC E1ARJ4.1
#=GS H2RWQ8_TAKRU/257-420  AC H2RWQ8.1
#=GS G3IHR8_CRIGR/405-566  AC G3IHR8.1
#=GS B6H9B6_PENCW/194-354  AC B6H9B6.1
#=GS A3YW34_9SYNE/247-406  AC A3YW34.1
#=GS H1RKE5_COMTE/236-395  AC H1RKE5.1
#=GS D2B5X0_STRRD/177-301  AC D2B5X0.1
#=GS C7Q1U7_CATAD/280-440  AC C7Q1U7.1
#=GS E4T730_PALPW/233-395  AC E4T730.1
#=GS Q466R0_METBF/181-341  AC Q466R0.1
#=GS H1XT89_9BACT/186-348  AC H1XT89.1
#=GS B8KU67_9GAMM/199-375  AC B8KU67.1
#=GS F1SQY7_PIG/156-313    AC F1SQY7.1
#=GS I1FL25_AMPQE/152-277  AC I1FL25.1
#=GS SAHH_PSESM/199-381    AC Q87V73.1
#=GS F6GHJ0_LACS5/197-358  AC F6GHJ0.1
#=GS C9UQ16_BRUAO/227-386  AC C9UQ16.1
#=GS G3YZ70_9LACO/182-330  AC G3YZ70.1
#=GS H2T1G2_TAKRU/358-519  AC H2T1G2.1
#=GS E6TPD5_MYCSR/244-406  AC E6TPD5.1
#=GS E9D3K1_COCPS/194-355  AC E9D3K1.1
#=GS B9NYW8_PROMR/233-392  AC B9NYW8.1
#=GS SAHH_RHOPA/230-389    AC Q6N2N5.1
#=GS G8PN05_PSEUV/236-395  AC G8PN05.1
#=GS H2JQ72_STRHJ/243-405  AC H2JQ72.1
#=GS B9K6V8_THENN/174-335  AC B9K6V8.1
#=GS D9ZCI5_9CARY/1-123    AC D9ZCI5.1
#=GS F6G656_RALS8/231-390  AC F6G656.1
#=GS A3SKW8_9RHOB/227-386  AC A3SKW8.1
#=GS C7NPA1_HALUD/190-351  AC C7NPA1.1
#=GS SAHH_METNO/229-388    AC B8IPU4.1
#=GS F0XJF2_GROCL/194-355  AC F0XJF2.1
#=GS SAHH_AGRRK/227-386    AC B9JG53.1
#=GS Q0VL82_ALCBS/198-374  AC Q0VL82.1
#=GS G2LEA4_CHLTF/193-355  AC G2LEA4.1
#=GS H8GG32_METAL/190-349  AC H8GG32.1
#=GS F3LV30_9BURK/237-397  AC F3LV30.1
#=GS Q3U5U5_MOUSE/191-352  AC Q3U5U5.1
#=GS E3S8A7_PYRTT/194-355  AC E3S8A7.1
#=GS SAHH_DESVH/238-400    AC Q72EH1.1
#=GS E2VYV9_MYCTU/253-415  AC E2VYV9.1
#=GS Q3R6C1_XYLFA/238-400  AC Q3R6C1.1
#=GS D6SPK6_9DELT/188-348  AC D6SPK6.1
#=GS A3M762_ACIBT/197-372  AC A3M762.2
#=GS G7G9Z3_9GAMM/197-372  AC G7G9Z3.1
#=GS F3F6Z1_9PSED/71-135   AC F3F6Z1.1
#=GS SAHH_LEPBL/196-358    AC Q04WX0.1
#=GS Q2L174_BORA1/232-392  AC Q2L174.1
#=GS G8X537_FLACA/197-358  AC G8X537.1
#=GS G7W5X5_DESOD/186-347  AC G7W5X5.1
#=GS D0BXZ3_9GAMM/197-372  AC D0BXZ3.1
#=GS E1XXD6_LEGPN/202-361  AC E1XXD6.1
#=GS F2CZE7_HORVD/240-403  AC F2CZE7.1
#=GS A6G922_9DELT/197-359  AC A6G922.1
#=GS E2U2U8_MYCTU/253-415  AC E2U2U8.1
#=GS B2H8R8_BURPE/234-393  AC B2H8R8.1
#=GS B9LQR3_HALLT/194-355  AC B9LQR3.1
#=GS H2PNH4_PONAB/370-531  AC H2PNH4.1
#=GS H5URW0_9MICO/236-398  AC H5URW0.1
#=GS E3J0X6_FRASU/199-361  AC E3J0X6.1
#=GS D0MGJ5_RHOM4/189-350  AC D0MGJ5.1
#=GS G6XKE5_9PROT/191-350  AC G6XKE5.1
#=GS D9U9W3_RHYRA/7-24     AC D9U9W3.1
#=GS D2ZNG9_METSM/183-344  AC D2ZNG9.1
#=GS C7KYV3_ACEPA/189-348  AC C7KYV3.1
#=GS A4YIZ3_METS5/196-357  AC A4YIZ3.1
#=GS E4XXS9_OIKDI/410-571  AC E4XXS9.1
#=GS A0LS32_ACIC1/234-396  AC A0LS32.1
#=GS G9N875_HYPVG/194-355  AC G9N875.1
#=GS C4FM76_9AQUI/185-346  AC C4FM76.1
#=GS I0I3H7_9CHLR/192-353  AC I0I3H7.1
#=GS G0HQF2_HALHT/168-329  AC G0HQF2.1
#=GS D5RK63_9PROT/195-354  AC D5RK63.1
#=GS B1MF64_MYCA9/244-406  AC B1MF64.1
#=GS D8PBK2_9BACT/185-346  AC D8PBK2.1
#=GS H3A2V3_LATCH/276-437  AC H3A2V3.1
#=GS D5BCE6_ZUNPS/192-353  AC D5BCE6.1
#=GS G3GZ56_CRIGR/159-320  AC G3GZ56.1
#=GS D5GNP5_TUBMM/161-322  AC D5GNP5.1
#=GS D0RQF9_9PROT/189-348  AC D0RQF9.1
#=GS SAHH_PROMM/237-396    AC Q7V926.1
#=GS D0SAC1_ACIJO/197-372  AC D0SAC1.1
#=GS D5H885_SALRM/189-350  AC D5H885.1
#=GS F3HDA4_PSEYM/169-256  AC F3HDA4.1
#=GS G7UPR6_PSEUP/239-400  AC G7UPR6.1
#=GS F4JTV4_ARATH/195-358  AC F4JTV4.1
#=GS D6Y6B6_THEBD/186-348  AC D6Y6B6.1
#=GS G3YG20_ASPNA/194-355  AC G3YG20.1
#=GS C6WJ47_ACTMD/248-410  AC C6WJ47.1
#=GS G3UGZ1_LOXAF/291-353  AC G3UGZ1.1
#=GS B0SIG6_LEPBA/199-361  AC B0SIG6.1
#=GS H2HWM2_CORDP/236-398  AC H2HWM2.1
#=GS D5Y8I0_MYCTU/253-415  AC D5Y8I0.1
#=GS Q2NFD5_METST/184-345  AC Q2NFD5.1
#=GS F6AFY4_PSEF1/194-376  AC F6AFY4.1
#=GS A5GQ50_SYNR3/239-398  AC A5GQ50.1
#=GS D5SIX6_STRCL/300-459  AC D5SIX6.1
#=GS E4QPL4_METS6/230-389  AC E4QPL4.1
#=GS SAHH_RHOPS/230-389    AC Q13AQ5.1
#=GS A4A9E5_9GAMM/199-375  AC A4A9E5.1
#=GS F0Q1E6_ACIAP/176-325  AC F0Q1E6.1
#=GS A4AWF2_MARSH/197-358  AC A4AWF2.1
#=GS A3TQV3_9MICO/236-398  AC A3TQV3.1
#=GS E0TE34_PARBH/225-384  AC E0TE34.1
#=GS H9UF27_9SPIO/255-417  AC H9UF27.1
#=GS H4FAB5_9RHIZ/226-385  AC H4FAB5.1
#=GS A8PQ38_9COXI/198-357  AC A8PQ38.1
#=GS B1FL08_9BURK/233-392  AC B1FL08.1
#=GS E4RJU1_HALSL/186-347  AC E4RJU1.1
#=GS Q8G5A1_BIFLO/261-420  AC Q8G5A1.1
#=GS SAHH_PSEF5/199-381    AC Q4K4H7.1
#=GS E1FVC1_LOALO/222-383  AC E1FVC1.1
#=GS D7B5Q9_NOCDD/188-350  AC D7B5Q9.1
#=GS SAHH_PSEPF/199-381    AC Q3K5D7.1
#=GS F1VXK6_9BURK/240-399  AC F1VXK6.1
#=GS SAHH_XANOM/238-400    AC Q2NZE3.1
#=GS E2BIK4_HARSA/192-353  AC E2BIK4.1
#=GS H2TA81_TAKRU/249-404  AC H2TA81.1
#=GS SAHH_METS4/229-388    AC B0UM37.1
#=GS F1P3F1_CHICK/197-358  AC F1P3F1.1
#=GS B1Y9X2_THENV/204-366  AC B1Y9X2.1
#=GS F7N9W0_XYLFA/238-400  AC F7N9W0.1
#=GS A5ZYE9_9FIRM/161-208  AC A5ZYE9.1
#=GS SAHH_TRIVA/244-406    AC P51540.1
#=GS C5A710_THEGJ/188-349  AC C5A710.1
#=GS C9T3C5_9RHIZ/227-386  AC C9T3C5.1
#=GS A3X7G2_9RHOB/228-387  AC A3X7G2.1
#=GS E1NTB9_9LACO/182-330  AC E1NTB9.1
#=GS D5T6Q2_LEGP2/155-277  AC D5T6Q2.1
#=GS G4R9F7_PELHB/227-386  AC G4R9F7.1
#=GS F5J2L6_9PORP/232-394  AC F5J2L6.1
#=GS Q6ZMM9_HUMAN/153-312  AC Q6ZMM9.1
#=GS F1WMK0_MORCA/208-381  AC F1WMK0.1
#=GS G1SBL6_NOMLE/191-352  AC G1SBL6.1
#=GS Q4Q124_LEIMA/190-351  AC Q4Q124.1
#=GS Q4Q124_LEIMA/190-351  DR PDB; 3G1U C; 190-351;
#=GS Q4Q124_LEIMA/190-351  DR PDB; 3G1U B; 190-351;
#=GS Q4Q124_LEIMA/190-351  DR PDB; 3G1U D; 190-351;
#=GS Q4Q124_LEIMA/190-351  DR PDB; 3G1U A; 190-351;
#=GS SAHH_LEPIC/196-358    AC Q75FU8.1
#=GS G0CXA8_CORUB/237-399  AC G0CXA8.1
#=GS C6T8D6_SOYBN/1-23     AC C6T8D6.1
#=GS D0KXU8_HALNC/198-382  AC D0KXU8.1
#=GS B4PMV7_DROYA/252-413  AC B4PMV7.1
#=GS G2NC96_9ACTO/243-405  AC G2NC96.1
#=GS C1EH64_MICSR/243-405  AC C1EH64.1
#=GS G5DY95_9PIPI/1-88     AC G5DY95.1
#=GS D2HBI3_AILME/284-445  AC D2HBI3.1
#=GS Q9SP98_SOLCH/115-171  AC Q9SP98.1
#=GS Q3J6C7_RHOS4/224-383  AC Q3J6C7.1
#=GS A1KYB0_TOBAC/240-403  AC A1KYB0.1
#=GS B4IXV3_DROGR/282-443  AC B4IXV3.1
#=GS B4LBA6_DROVI/281-442  AC B4LBA6.1
#=GS Q0YP32_9CHLB/231-393  AC Q0YP32.1
#=GS Q2PEU5_TRIPR/240-403  AC Q2PEU5.1
#=GS Q41974_ARATH/36-121   AC Q41974.1
#=GS C3X5Q1_OXAFO/231-390  AC C3X5Q1.1
#=GS Q069K5_9SOLA/240-403  AC Q069K5.1
#=GS F7A3T8_ORNAN/262-423  AC F7A3T8.1
#=GS SAHH_SOLLC/240-403    AC Q9SWF5.1
#=GS E6VM93_RHOPX/230-389  AC E6VM93.1
#=GS E5SW26_TRISP/187-348  AC E5SW26.1
#=GS G4E8Z8_9GAMM/337-496  AC G4E8Z8.1
#=GS C0ZWY9_RHOE4/250-412  AC C0ZWY9.1
#=GS E2CEJ5_9RHOB/223-382  AC E2CEJ5.1
#=GS SAHH_MYCSS/248-409    AC Q1BCD6.1
#=GS SAHH_RHILO/227-386    AC Q98CM3.1
#=GS H2M598_ORYLA/269-430  AC H2M598.1
#=GS D9U9W9_SMICR/7-24     AC D9U9W9.1
#=GS B6B5W2_9RHOB/223-382  AC B6B5W2.1
#=GS A6WER2_KINRD/240-407  AC A6WER2.1
#=GS E3F164_KETVY/225-384  AC E3F164.1
#=GS H0JKW6_9NOCA/247-409  AC H0JKW6.1
#=GS B2ACR6_PODAN/190-351  AC B2ACR6.1
#=GS H5ULL4_9ACTO/248-409  AC H5ULL4.1
#=GS SAHH_MESCR/240-403    AC P93253.1
#=GS A4HPQ8_LEIBR/190-351  AC A4HPQ8.1
#=GS I0S2P9_MYCPH/244-405  AC I0S2P9.1
#=GS SAHH_SOLUE/234-395    AC Q01VU1.1
#=GS F3GX18_PSESX/199-381  AC F3GX18.1
#=GS C3N5P5_SULIA/203-364  AC C3N5P5.1
#=GS B2IFN0_BEII9/230-389  AC B2IFN0.1
#=GS H2J7S2_MARPK/177-338  AC H2J7S2.1
#=GS D5CU83_SIDLE/229-388  AC D5CU83.1
#=GS F2T0V4_TRIRC/194-302  AC F2T0V4.1
#=GS G2E443_9GAMM/229-388  AC G2E443.1
#=GS B9JXY0_AGRVS/270-429  AC B9JXY0.1
#=GS Q7KSG0_DROME/252-413  AC Q7KSG0.1
#=GS A5IKP9_THEP1/174-335  AC A5IKP9.1
#=GS C7M131_ACIFD/185-352  AC C7M131.1
#=GS G0THM5_MYCCP/253-415  AC G0THM5.1
#=GS B7WX05_COMTE/236-395  AC B7WX05.1
#=GS SAHH_BARHE/226-385    AC Q6G584.1
#=GS F2L4F5_THEU7/204-366  AC F2L4F5.1
#=GS F7H6W0_MACMU/369-530  AC F7H6W0.1
#=GS H8KN95_SOLCM/201-362  AC H8KN95.1
#=GS D0CC64_ACIBA/197-372  AC D0CC64.1
#=GS G4JND2_9CREN/184-346  AC G4JND2.1
#=GS H8JCU5_MYCIT/248-410  AC H8JCU5.1
#=GS F1MWH2_BOVIN/289-450  AC F1MWH2.2
#=GS B4VSC6_9CYAN/192-353  AC B4VSC6.1
#=GS Q6BHB2_DEBHA/194-355  AC Q6BHB2.1
#=GS SAHH_MARMM/230-389    AC Q0ALW1.1
#=GS H6REB5_9BACT/226-385  AC H6REB5.1
#=GS Q5LLR0_SILPO/223-382  AC Q5LLR0.1
#=GS G0ETD1_CUPNN/231-390  AC G0ETD1.1
#=GS D3E562_GEOS4/190-351  AC D3E562.1
#=GS SAHH_MYCBO/253-415    AC Q7TWW7.3
#=GS F1WCC6_MORCA/208-381  AC F1WCC6.1
#=GS E4M1Z5_9FIRM/188-349  AC E4M1Z5.1
#=GS F5IP14_ACIBA/197-372  AC F5IP14.1
#=GS G3W7X0_SARHA/268-429  AC G3W7X0.1
#=GS F8ICH2_ALIAT/181-342  AC F8ICH2.1
#=GS E8NG30_MICTS/183-344  AC E8NG30.1
#=GS A7XB36_PETHY/240-403  AC A7XB36.1
#=GS D5U359_THEAM/185-347  AC D5U359.1
#=GS F0C4M1_9XANT/238-400  AC F0C4M1.1
#=GS SAHH_DESDG/238-400    AC Q30WL8.1
#=GS H0IUD9_MYCAB/249-411  AC H0IUD9.1
#=GS C0E124_9CORY/236-398  AC C0E124.1
#=GS G7H286_9ACTO/255-417  AC G7H286.1
#=GS H8Z1A0_9GAMM/234-393  AC H8Z1A0.1
#=GS G3J113_9GAMM/187-348  AC G3J113.1
#=GS H2Z7J0_CIOSA/214-375  AC H2Z7J0.1
#=GS G6XU52_RHIRD/227-386  AC G6XU52.1
#=GS A0DP58_PARTE/276-353  AC A0DP58.1
#=GS H9KB63_APIME/192-353  AC H9KB63.1
#=GS A3RPV6_RALSL/231-390  AC A3RPV6.1
#=GS Q80WX1_MOUSE/3-108    AC Q80WX1.1
#=GS C7KPI8_ACEPA/189-348  AC C7KPI8.1
#=GS Q4D455_TRYCC/190-351  AC Q4D455.1
#=GS F3KU88_9BURK/235-394  AC F3KU88.1
#=GS G6FV46_9CYAN/192-353  AC G6FV46.1
#=GS A4LN87_BURPE/234-393  AC A4LN87.1
#=GS D6D9H9_BIFLN/205-364  AC D6D9H9.1
#=GS I1QZZ3_ORYGL/240-403  AC I1QZZ3.1
#=GS G2N7Q5_MYCTU/253-415  AC G2N7Q5.1
#=GS F8CBS0_MYXFH/236-395  AC F8CBS0.1
#=GS Q2J4J2_FRASC/236-398  AC Q2J4J2.1
#=GS F4QKH0_9CAUL/233-392  AC F4QKH0.1
#=GS D9U9W1_DIDMA/7-24     AC D9U9W1.1
#=GS B9Q7N9_TOXGO/232-395  AC B9Q7N9.1
#=GS E2A3R3_CAMFO/265-426  AC E2A3R3.1
#=GS SAHH_DELAS/236-395    AC A9C184.1
#=GS Q5CBE4_9THEM/183-344  AC Q5CBE4.1
#=GS SAHH_CHLCH/231-393    AC Q3AQC2.1
#=GS A4BYB4_9FLAO/197-358  AC A4BYB4.1
#=GS D3SE55_THISK/231-390  AC D3SE55.1
#=GS E4Z315_OIKDI/91-252   AC E4Z315.1
#=GS B5HIQ1_STRPR/232-394  AC B5HIQ1.2
#=GS Q0G6R0_9RHIZ/227-386  AC Q0G6R0.1
#=GS G3VVH8_SARHA/289-450  AC G3VVH8.1
#=GS SAHH_CORDI/236-398    AC P61456.1
#=GS H8LQE5_CORPS/237-399  AC H8LQE5.1
#=GS C6XL65_HIRBI/226-385  AC C6XL65.1
#=GS E4QD24_CALH1/185-346  AC E4QD24.1
#=GS Q4RXQ1_TETNG/250-411  AC Q4RXQ1.1
#=GS G7YXQ7_CLOSI/107-216  AC G7YXQ7.1
#=GS D9XJ79_9ACTO/169-327  AC D9XJ79.1
#=GS G8NVU2_GRAMM/235-397  AC G8NVU2.1
#=GS A5ZB66_9BACE/236-398  AC A5ZB66.1
#=GS SAHH_BURTA/234-393    AC Q2STU0.1
#=GS F6GTM7_VITVI/240-403  AC F6GTM7.1
#=GS B6ATE2_9RHOB/223-382  AC B6ATE2.1
#=GS A4FGJ3_SACEN/244-406  AC A4FGJ3.1
#=GS A3JM62_9RHOB/224-383  AC A3JM62.1
#=GS SAHH_PLAYO/234-396    AC Q7RKK8.1
#=GS D9UQ05_9ACTO/244-406  AC D9UQ05.1
#=GS A1D366_NEOFI/194-355  AC A1D366.1
#=GS G0BV78_9ENTR/175-324  AC G0BV78.1
#=GS A6EFW6_9SPHI/197-358  AC A6EFW6.1
#=GS SAHH_RHOCB/224-383    AC P28183.2
#=GS SAHH_PSEP1/199-381    AC A5WA09.1
#=GS D8VMB1_9NEOP/53-213   AC D8VMB1.1
#=GS F8F6X8_PAEMK/135-261  AC F8F6X8.1
#=GS D1NJ48_CLOTM/184-345  AC D1NJ48.1
#=GS E1TCG9_BURSG/234-393  AC E1TCG9.1
#=GS SAHH_STRAZ/227-389    AC Q8GGL7.1
#=GS C7LQI3_DESBD/233-395  AC C7LQI3.1
#=GS SAHH_GEOSL/236-395    AC P61617.1
#=GS SAHH_PSEMY/199-381    AC A4XPF3.1
#=GS B3C7N8_9BACE/232-394  AC B3C7N8.1
#=GS G0P174_CAEBE/193-354  AC G0P174.1
#=GS Q2LSQ9_SYNAS/279-441  AC Q2LSQ9.1
#=GS B2FPC3_STRMK/239-401  AC B2FPC3.1
#=GS G3W7X1_SARHA/268-429  AC G3W7X1.1
#=GS G2GH70_9ACTO/243-405  AC G2GH70.1
#=GS G6HMM1_9ACTO/200-362  AC G6HMM1.1
#=GS Q66IP1_XENLA/279-440  AC Q66IP1.1
#=GS A6QNP1_BOVIN/35-196   AC A6QNP1.1
#=GS SAHH_MESSB/226-385    AC Q11CD0.1
#=GS C4XQV1_DESMR/234-396  AC C4XQV1.1
#=GS D5EQ42_CORAD/233-399  AC D5EQ42.1
#=GS F2RH42_STRVP/225-387  AC F2RH42.1
#=GS Q2CJM8_9RHOB/222-381  AC Q2CJM8.1
#=GS Q6PC06_DANRE/350-511  AC Q6PC06.1
#=GS H2G757_CORDP/236-398  AC H2G757.1
#=GS F8E0Z8_CORRG/210-376  AC F8E0Z8.1
#=GS A2W5Y6_9BURK/234-393  AC A2W5Y6.1
#=GS G2FFT6_9GAMM/228-387  AC G2FFT6.1
#=GS Q3SFY4_THIDA/267-432  AC Q3SFY4.1
#=GS G3SHN5_GORGO/191-352  AC G3SHN5.1
#=GS SAHH_MYCS2/244-405    AC A4ZHR8.1
#=GS H0K3P8_9PSEU/243-405  AC H0K3P8.1
#=GS Q24LN1_PAVLU/134-295  AC Q24LN1.1
#=GS C7XFD8_9PORP/232-394  AC C7XFD8.1
#=GS Q1NYG3_9DELT/196-355  AC Q1NYG3.1
#=GS G3LPE2_9BRAS/1-124    AC G3LPE2.1
#=GS F6SNC6_CIOIN/223-384  AC F6SNC6.2
#=GS A5PMG3_DANRE/259-420  AC A5PMG3.1
#=GS I1K3S4_SOYBN/240-403  AC I1K3S4.1
#=GS F8PK80_SERL3/189-350  AC F8PK80.1
#=GS H6NG88_9BACL/189-350  AC H6NG88.1
#=GS B4IBP7_DROSE/252-413  AC B4IBP7.1
#=GS D5EA49_METMS/228-390  AC D5EA49.1
#=GS Q5CBL5_9THEM/174-335  AC Q5CBL5.1
#=GS G4SUH2_META2/191-350  AC G4SUH2.1
#=GS A9A2E9_NITMS/184-345  AC A9A2E9.1
#=GS H0X841_OTOGA/289-450  AC H0X841.1
#=GS D5Z893_MYCTU/253-415  AC D5Z893.1
#=GS D4Z1N5_SPHJU/230-389  AC D4Z1N5.1
#=GS D4T7X9_9XANT/238-400  AC D4T7X9.1
#=GS D3LUW8_9FIRM/184-345  AC D3LUW8.1
#=GS G8NK06_BRUSS/227-386  AC G8NK06.1
#=GS B2Q516_PROST/188-349  AC B2Q516.1
#=GS B9J9W2_AGRRK/171-334  AC B9J9W2.1
#=GS A7NFR5_ROSCS/187-348  AC A7NFR5.1
#=GS H3DCE5_TETNG/314-476  AC H3DCE5.1
#=GS A3TXW8_9RHOB/223-382  AC A3TXW8.1
#=GS G4FH86_THEMA/174-335  AC G4FH86.1
#=GS B8LLP3_PICSI/240-403  AC B8LLP3.1
#=GS F6W2S1_ORNAN/191-352  AC F6W2S1.1
#=GS Q5WV19_LEGPL/202-361  AC Q5WV19.1
#=GS G2PM46_MURRD/197-358  AC G2PM46.1
#=GS B9GFJ3_POPTR/240-403  AC B9GFJ3.1
#=GS F8LV50_STRTR/347-494  AC F8LV50.1
#=GS H1WJF3_9CYAN/192-353  AC H1WJF3.1
#=GS B3MR98_DROAN/191-352  AC B3MR98.1
#=GS D6JUI6_ACIG3/198-373  AC D6JUI6.1
#=GS I0V6F2_9PSEU/246-408  AC I0V6F2.1
#=GS H0RF67_9ACTO/251-412  AC H0RF67.1
#=GS B4ILS9_DROSE/191-352  AC B4ILS9.1
#=GS C5ASM2_METEA/229-388  AC C5ASM2.1
#=GS A3ERN9_9BACT/185-346  AC A3ERN9.1
#=GS F7S8D6_9PROT/195-354  AC F7S8D6.1
#=GS F3ZQU7_9BACE/232-394  AC F3ZQU7.1
#=GS D6TJE1_9CHLR/189-350  AC D6TJE1.1
#=GS B5YHE1_THEYD/186-347  AC B5YHE1.1
#=GS Q6FWX3_CANGA/194-355  AC Q6FWX3.1
#=GS E2REN1_CANFA/163-324  AC E2REN1.1
#=GS D2SFJ4_GEOOG/250-412  AC D2SFJ4.1
#=GS F4WQS6_ACREC/287-448  AC F4WQS6.1
#=GS Q753T3_ASHGO/194-355  AC Q753T3.1
#=GS F3WUH8_9SPHN/233-392  AC F3WUH8.1
#=GS E0DD48_9CORY/236-398  AC E0DD48.1
#=GS F4QAM4_DICFS/194-354  AC F4QAM4.1
#=GS G1V277_9DELT/235-397  AC G1V277.1
#=GS G3Q588_GASAC/362-523  AC G3Q588.1
#=GS F8WGT1_MOUSE/371-532  AC F8WGT1.1
#=GS SAHH_TOBAC/240-403    AC P68173.1
#=GS Q5CI16_CRYHO/244-407  AC Q5CI16.1
#=GS A8LCE0_FRASN/236-398  AC A8LCE0.1
#=GS G0I5B7_CORPS/237-399  AC G0I5B7.1
#=GS E4R9D1_PSEPB/199-381  AC E4R9D1.1
#=GS SAHH_BURP0/234-393    AC A3P0L8.1
#=GS G3R806_GORGO/289-450  AC G3R806.1
#=GS D8KA87_NITWC/198-357  AC D8KA87.1
#=GS SAHH_GLOVI/194-355    AC Q7NGI6.1
#=GS F6SIF5_MONDO/331-492  AC F6SIF5.1
#=GS D5YJL6_MYCTU/253-415  AC D5YJL6.1
#=GS G5ZXB9_9PROT/225-384  AC G5ZXB9.1
#=GS A7XB43_ARATH/240-403  AC A7XB43.1
#=GS F2LHI6_BURGS/233-392  AC F2LHI6.1
#=GS D5XYR8_MYCTU/253-415  AC D5XYR8.1
#=GS SAHH_PSEU2/199-381    AC Q4ZZ92.1
#=GS E3E8G6_PAEPS/190-351  AC E3E8G6.1
#=GS G7N511_MACMU/191-354  AC G7N511.1
#=GS G0HNQ3_THES4/188-349  AC G0HNQ3.1
#=GS G6IFN6_9DELT/240-402  AC G6IFN6.1
#=GS C8PZZ4_9GAMM/205-378  AC C8PZZ4.1
#=GS B6T440_MAIZE/240-403  AC B6T440.1
#=GS E8LD00_9FIRM/184-346  AC E8LD00.1
#=GS F7GT77_MACMU/191-354  AC F7GT77.1
#=GS E9ETM7_METAR/194-355  AC E9ETM7.1
#=GS F6WEW4_MOUSE/4-108    AC F6WEW4.1
#=GS SAHH_CHLP8/231-393    AC B3QMF5.1
#=GS A1RRW2_PYRIL/210-372  AC A1RRW2.1
#=GS C5C9B9_MICLC/265-431  AC C5C9B9.1
#=GS SAHH_PROM2/233-392    AC A8G7D1.1
#=GS B8G010_DESHD/196-357  AC B8G010.1
#=GS Q5EN86_AURAU/1-122    AC Q5EN86.1
#=GS H3LQF9_KLEOX/177-326  AC H3LQF9.1
#=GS F0VM57_NEOCL/232-395  AC F0VM57.1
#=GS G0CNN1_CORUL/237-399  AC G0CNN1.1
#=GS H2JG32_9CLOT/184-345  AC H2JG32.1
#=GS D6FRF0_MYCTU/253-415  AC D6FRF0.1
#=GS B8LLL7_PICSI/240-403  AC B8LLL7.1
#=GS SAHH_BACTN/236-398    AC Q8A407.1
#=GS A3PG19_RHOS1/224-383  AC A3PG19.1
#=GS B4PDB7_DROYA/280-441  AC B4PDB7.1
#=GS A3J3Z9_9FLAO/197-358  AC A3J3Z9.1
#=GS SAHH_RHOBA/196-366    AC Q7TTZ5.1
#=GS H3BEW1_LATCH/277-438  AC H3BEW1.1
#=GS SAHH_STRCO/243-405    AC Q9KZM1.1
#=GS Q2JWE2_SYNJA/193-354  AC Q2JWE2.1
#=GS F2KS93_ARCVS/170-330  AC F2KS93.1
#=GS A3W4F2_9RHOB/223-382  AC A3W4F2.1
#=GS H5WGH2_RALSL/231-390  AC H5WGH2.1
#=GS Q1ZK07_PHOAS/205-347  AC Q1ZK07.1
#=GS F4H4D2_CELFA/282-451  AC F4H4D2.1
#=GS D2H433_AILME/182-343  AC D2H433.1
#=GS D9U9W7_PHATA/7-24     AC D9U9W7.1
#=GS B6QRV5_PENMQ/194-355  AC B6QRV5.1
#=GS F7VDW9_9PROT/189-348  AC F7VDW9.1
#=GS B8GYC7_CAUCN/224-383  AC B8GYC7.1
#=GS H0P8Y8_9SYNC/192-353  AC H0P8Y8.1
#=GS SAHH_BRUME/227-386    AC Q8YE49.2
#=GS E8WN23_GEOS8/225-384  AC E8WN23.1
#=GS E4NR00_HALBP/192-353  AC E4NR00.1
#=GS C1DWN0_SULAA/185-346  AC C1DWN0.1
#=GS C0BKL7_9BACT/197-302  AC C0BKL7.1
#=GS C9YE72_9BURK/1-66     AC C9YE72.1
#=GS E6UNE6_CLOTL/184-345  AC E6UNE6.1
#=GS G3HAN8_CRIGR/191-352  AC G3HAN8.1
#=GS F6A341_GARVH/263-419  AC F6A341.1
#=GS SAHH_WHEAT/240-403    AC P32112.1
#=GS A5V9R4_SPHWW/230-389  AC A5V9R4.1
#=GS E8MHB3_BIFL2/261-420  AC E8MHB3.1
#=GS SAHH_PNECA/199-360    AC Q12663.1
#=GS D1CFK4_THET1/180-341  AC D1CFK4.1
#=GS B5DFN2_RAT/241-402    AC B5DFN2.1
#=GS C3Y544_BRAFL/194-354  AC C3Y544.1
#=GS B5K6Y3_9RHOB/226-385  AC B5K6Y3.1
#=GS H3PB89_BRUAO/227-386  AC H3PB89.1
#=GS SAHH_CYAP7/196-357    AC B7K8X6.1
#=GS G5GMN4_9FIRM/184-345  AC G5GMN4.1
#=GS H0Y8B3_HUMAN/277-438  AC H0Y8B3.1
#=GS F2LVT6_HIPMA/185-346  AC F2LVT6.1
#=GS Q2JKS3_SYNJB/193-354  AC Q2JKS3.1
#=GS F3M1N0_9LACO/180-328  AC F3M1N0.1
#=GS SAHH_HALS3/192-353    AC B0R7F2.1
#=GS D4U1Y4_9ACTO/1-119    AC D4U1Y4.1
#=GS F3Q2Y6_9ENTR/160-309  AC F3Q2Y6.1
#=GS C9TWP8_9RHIZ/227-386  AC C9TWP8.1
#=GS H0YZQ0_TAEGU/196-357  AC H0YZQ0.1
#=GS Q6P743_RAT/191-352    AC Q6P743.1
#=GS G3PDT1_GASAC/333-494  AC G3PDT1.1
#=GS H8I6W9_METCZ/181-342  AC H8I6W9.1
#=GS F8FU58_PSEPU/199-381  AC F8FU58.1
#=GS E9HK94_DAPPU/201-362  AC E9HK94.1
#=GS F5SD58_9BACL/186-347  AC F5SD58.1
#=GS H3BIH2_LATCH/266-427  AC H3BIH2.1
#=GS SAHH_AGRT5/227-386    AC Q8UJ99.1
#=GS SAHH_HUMAN/191-352    AC P23526.4
#=GS SAHH_HUMAN/191-352    DR PDB; 1A7A A; 191-352;
#=GS SAHH_HUMAN/191-352    DR PDB; 3NJ4 C; 191-352;
#=GS SAHH_HUMAN/191-352    DR PDB; 1LI4 A; 191-352;
#=GS SAHH_HUMAN/191-352    DR PDB; 3NJ4 B; 191-352;
#=GS SAHH_HUMAN/191-352    DR PDB; 3NJ4 A; 191-352;
#=GS SAHH_HUMAN/191-352    DR PDB; 3NJ4 D; 191-352;
#=GS SAHH_HUMAN/191-352    DR PDB; 1A7A B; 191-352;
#=GS F3E9E4_PSESL/199-381  AC F3E9E4.1
#=GS H0W4G1_CAVPO/252-413  AC H0W4G1.1
#=GS D4ZY15_SPIPL/192-353  AC D4ZY15.1
#=GS B5DP84_DROPS/268-429  AC B5DP84.1
#=GS B5ZRB2_RHILW/168-331  AC B5ZRB2.1
#=GS I0DVF4_PROST/188-349  AC I0DVF4.1
#=GS F2HTN5_BRUMM/227-386  AC F2HTN5.1
#=GS F7C6T2_HORSE/191-350  AC F7C6T2.1
#=GS G6CUJ8_DANPL/1-143    AC G6CUJ8.1
#=GS C8XJI5_NAKMY/257-418  AC C8XJI5.1
#=GS H2QVC8_PANTR/370-531  AC H2QVC8.1
#=GS B9CJC3_9BURK/233-392  AC B9CJC3.1
#=GS D1C2U0_SPHTD/190-352  AC D1C2U0.1
#=GS SAHH_RHOSH/224-383    AC O50562.1
#=GS G1LF84_AILME/309-470  AC G1LF84.1
#=GS H2GFA7_CORDP/236-398  AC H2GFA7.1
#=GS E2TRB0_MYCTU/253-415  AC E2TRB0.1
#=GS Q4P829_USTMA/188-349  AC Q4P829.1
#=GS SAHH_RHOP2/230-389    AC Q2IZR1.1
#=GS C6E2K7_GEOSM/226-385  AC C6E2K7.1
#=GS G1RQ14_NOMLE/370-531  AC G1RQ14.1
#=GS E9CHK0_CAPO3/192-352  AC E9CHK0.1
#=GS H0SHD7_9BRAD/232-391  AC H0SHD7.1
#=GS A3WQN6_9GAMM/197-373  AC A3WQN6.1
#=GS C5ZF88_BURPE/234-393  AC C5ZF88.1
#=GS E1K152_DESFR/234-396  AC E1K152.1
#=GS H2Z7J3_CIOSA/243-406  AC H2Z7J3.1
#=GS Q0AXW6_SYNWW/194-355  AC Q0AXW6.1
#=GS Q5L7L6_BACFN/232-394  AC Q5L7L6.1
#=GS D5BTB0_PUNMI/225-384  AC D5BTB0.1
#=GS A4X3J2_SALTO/254-416  AC A4X3J2.1
#=GS Q383X0_TRYB2/190-351  AC Q383X0.1
#=GS Q383X0_TRYB2/190-351  DR PDB; 3H9U D; 190-351;
#=GS Q383X0_TRYB2/190-351  DR PDB; 3H9U A; 190-351;
#=GS Q383X0_TRYB2/190-351  DR PDB; 3H9U C; 190-351;
#=GS Q383X0_TRYB2/190-351  DR PDB; 3H9U B; 190-351;
#=GS SAHH_BURXL/234-393    AC Q13T36.1
#=GS F9J0M7_ACIBA/197-372  AC F9J0M7.1
#=GS F6FRM5_ISOV2/263-435  AC F6FRM5.1
#=GS Q5FRZ9_GLUOX/198-357  AC Q5FRZ9.1
#=GS Q9M677_CUCME/1-85     AC Q9M677.1
#=GS D1CUK7_9RHIZ/227-386  AC D1CUK7.1
#=GS A9DZ30_9RHOB/224-383  AC A9DZ30.1
#=GS G4M0M7_SCHMA/279-440  AC G4M0M7.1
#=GS SAHH_CUPPJ/231-390    AC Q476T8.1
#=GS C5BTQ5_TERTT/198-374  AC C5BTQ5.1
#=GS F7NPB2_9FIRM/184-344  AC F7NPB2.1
#=GS I1AUF0_9RHOB/223-382  AC I1AUF0.1
#=GS B4PWM7_DROYA/191-352  AC B4PWM7.1
#=GS B8GEX2_METPE/177-336  AC B8GEX2.1
#=GS E4Q5K0_CALOW/185-346  AC E4Q5K0.1
#=GS F9ZPD9_ACICS/196-380  AC F9ZPD9.1
#=GS G1T1W6_RABIT/378-539  AC G1T1W6.1
#=GS SAHH_ACIAC/235-394    AC A1TUG3.1
#=GS G2SL70_RHOMR/189-350  AC G2SL70.1
#=GS A2DVT9_TRIVA/244-406  AC A2DVT9.1
#=GS F7UXX2_EEGSY/187-348  AC F7UXX2.1
#=GS G8R0T8_OWEHD/197-358  AC G8R0T8.1
#=GS Q5R045_IDILO/195-371  AC Q5R045.1
#=GS A0RXE6_CENSY/187-348  AC A0RXE6.1
#=GS Q7T2B5_DANRE/271-432  AC Q7T2B5.1
#=GS A9BIK7_PETMO/178-339  AC A9BIK7.1
#=GS H2YAU7_CIOSA/190-350  AC H2YAU7.1
#=GS G2UI80_PSEAI/195-377  AC G2UI80.1
#=GS B6VC73_GOSHI/240-403  AC B6VC73.1
#=GS F4B1B5_KROS4/197-358  AC F4B1B5.1
#=GS H2QK78_PANTR/191-352  AC H2QK78.1
#=GS Q2RNQ7_RHORT/226-385  AC Q2RNQ7.1
#=GS G5J1M5_CROWT/192-353  AC G5J1M5.1
#=GS G2WCS6_YEASK/194-355  AC G2WCS6.1
#=GS H2TK42_TAKRU/266-427  AC H2TK42.1
#=GS G2LSZ4_9XANT/238-400  AC G2LSZ4.1
#=GS E3GW01_METFV/184-345  AC E3GW01.1
#=GS SAHH_ARCFU/173-333    AC O28279.1
#=GS H2M594_ORYLA/362-523  AC H2M594.1
#=GS B7FT14_PHATC/238-398  AC B7FT14.1
#=GS C4KD20_THASP/232-391  AC C4KD20.1
#=GS I0GQ60_SELRU/184-345  AC I0GQ60.1
#=GS H1YYT6_9EURY/175-334  AC H1YYT6.1
#=GS B5XPI3_KLEP3/177-326  AC B5XPI3.1
#=GS B7I3L1_ACIB5/197-372  AC B7I3L1.1
#=GS C6B2H6_RHILS/168-331  AC C6B2H6.1
#=GS F2NKV6_MARHT/186-347  AC F2NKV6.1
#=GS H5U5A3_9ACTO/295-456  AC H5U5A3.1
#=GS H8IYR9_MYCIT/248-410  AC H8IYR9.1
#=GS A4B9W4_9GAMM/178-326  AC A4B9W4.1
#=GS Q5X3N1_LEGPA/202-361  AC Q5X3N1.1
#=GS D0NEK2_PHYIT/237-397  AC D0NEK2.1
#=GS B0WWT2_CULQU/216-379  AC B0WWT2.1
#=GS Q5W1I5_NICGL/19-182   AC Q5W1I5.1
#=GS D2W1E4_NAEGR/233-395  AC D2W1E4.1
#=GS H3DAX7_TETNG/267-428  AC H3DAX7.1
#=GS D8JRB7_HYPDA/230-389  AC D8JRB7.1
#=GS I0GIU1_9BACT/174-335  AC I0GIU1.1
#=GS D0TJP8_9BACE/232-394  AC D0TJP8.1
#=GS D9YAW6_9DELT/233-395  AC D9YAW6.1
#=GS C7HI31_CLOTM/184-345  AC C7HI31.1
#=GS D5SVR7_PLAL2/202-370  AC D5SVR7.1
#=GS E1NKP8_9LACO/182-330  AC E1NKP8.1
#=GS F5XX10_RAMTT/237-397  AC F5XX10.1
#=GS C4KXJ0_BURPE/234-393  AC C4KXJ0.1
#=GS D7E1N9_NOSA0/192-353  AC D7E1N9.1
#=GS G0R4D6_ICHMG/233-395  AC G0R4D6.1
#=GS A4EH43_9RHOB/255-414  AC A4EH43.1
#=GS A6TBA9_KLEP7/177-326  AC A6TBA9.1
#=GS C7MUK9_SACVD/243-405  AC C7MUK9.1
#=GS F7GIN0_MACMU/289-450  AC F7GIN0.1
#=GS B0C8A5_ACAM1/197-373  AC B0C8A5.1
#=GS A7AB33_9PORP/232-394  AC A7AB33.1
#=GS D8VME5_9NEOP/53-213   AC D8VME5.1
#=GS H3M7E1_KLEOX/177-326  AC H3M7E1.1
#=GS H1G1W0_9GAMM/232-391  AC H1G1W0.1
#=GS E1WZA8_BACMS/191-351  AC E1WZA8.1
#=GS A5WDX4_PSYWF/209-385  AC A5WDX4.1
#=GS E1RQ35_XYLFG/238-400  AC E1RQ35.1
#=GS D7E8L4_METEZ/181-341  AC D7E8L4.1
#=GS D8VMC6_9NEOP/53-213   AC D8VMC6.1
#=GS SAHH_VARPS/239-398    AC C5CM29.1
#=GS G4FN30_9SYNE/237-396  AC G4FN30.1
#=GS B3VIF0_POPTN/1-115    AC B3VIF0.1
#=GS Q49S41_DANRE/259-420  AC Q49S41.1
#=GS B7PCR2_IXOSC/163-325  AC B7PCR2.1
#=GS D6Y6B5_THEBD/233-395  AC D6Y6B5.1
#=GS D6FLF4_MYCTU/253-415  AC D6FLF4.1
#=GS E2UEQ0_MYCTU/253-415  AC E2UEQ0.1
#=GS Q2NB41_ERYLH/230-389  AC Q2NB41.1
#=GS A2STC1_METLZ/175-334  AC A2STC1.1
#=GS SAHH_DICDI/191-351    AC P10819.2
#=GS SAHH_COXBU/199-358    AC Q83A77.2
#=GS E8RMM4_ASTEC/249-408  AC E8RMM4.1
#=GS B1I2P2_DESAP/185-346  AC B1I2P2.1
#=GS F4DLI2_PSEMN/193-375  AC F4DLI2.1
#=GS F8ADT9_THEID/185-346  AC F8ADT9.1
#=GS D6V2K9_9BRAD/229-388  AC D6V2K9.1
#=GS Q4TEC7_TETNG/65-239   AC Q4TEC7.1
#=GS C9CY57_9RHOB/223-381  AC C9CY57.1
#=GS A0K3E9_BURCH/233-392  AC A0K3E9.1
#=GS A5CW73_VESOH/197-373  AC A5CW73.1
#=GS Q4RBV4_TETNG/1-93     AC Q4RBV4.1
#=GS G3NHJ8_GASAC/192-353  AC G3NHJ8.1
#=GS F5RM84_9FIRM/184-345  AC F5RM84.1
#=GS D6WMI3_TRICA/191-352  AC D6WMI3.1
#=GS Q3RF05_XYLFA/238-400  AC Q3RF05.1
#=GS G8B6I2_CANPC/194-355  AC G8B6I2.1
#=GS G0FNL9_AMYMD/248-410  AC G0FNL9.1
#=GS Q49S42_DANRE/313-474  AC Q49S42.1
#=GS B4K1W7_DROGR/1-143    AC B4K1W7.1
#=GS G8U1D0_9FIRM/184-346  AC G8U1D0.1
#=GS SAHHA_XENLA/192-353   AC P51893.1
#=GS D4X350_BACOV/232-394  AC D4X350.1
#=GS Q5CPH1_CRYPI/246-409  AC Q5CPH1.1
#=GS D9UWZ3_9ACTO/240-402  AC D9UWZ3.1
#=GS B4S716_PROA2/232-394  AC B4S716.1
#=GS H2PZL8_PANTR/289-450  AC H2PZL8.1
#=GS A5PMG4_DANRE/313-474  AC A5PMG4.1
#=GS SAHH_XYLF2/238-400    AC B2I7N4.1
#=GS F8KZ72_PARAV/201-364  AC F8KZ72.1
#=GS H0HCX1_RHIRD/227-386  AC H0HCX1.1
#=GS SAHH_COXB2/199-358    AC B6J3R0.1
#=GS Q3ZZN6_DEHSC/185-346  AC Q3ZZN6.1
#=GS A3LHP0_PSEAI/199-381  AC A3LHP0.1
#=GS F6T5I3_MONDO/322-483  AC F6T5I3.1
#=GS Q5CBQ5_THENE/174-335  AC Q5CBQ5.1
#=GS Q4RHJ7_TETNG/355-462  AC Q4RHJ7.1
#=GS A2TQB7_9FLAO/197-358  AC A2TQB7.1
#=GS Q6WN55_BRABE/194-354  AC Q6WN55.1
#=GS D9Q6W2_CORP1/237-399  AC D9Q6W2.1
#=GS B6IV07_RHOCS/199-358  AC B6IV07.1
#=GS H2WF06_CAEJA/196-357  AC H2WF06.1
#=GS G7WLW0_METH6/184-345  AC G7WLW0.1
#=GS SAHH_SPHAL/233-392    AC Q1GWT5.1
#=GS A6R164_AJECN/462-623  AC A6R164.1
#=GS F8GKE5_NITSI/238-397  AC F8GKE5.1
#=GS C7NZX9_HALMD/190-351  AC C7NZX9.1
#=GS G4QA77_TAYAM/226-385  AC G4QA77.1
#=GS SAHH_ACIAD/204-379    AC Q6FA43.1
#=GS D9PMP0_9ZZZZ/76-164   AC D9PMP0.1
#=GS B8GP48_THISH/231-390  AC B8GP48.1
#=GS H2Z7I7_CIOSA/288-449  AC H2Z7I7.1
#=GS B0VFI4_CLOAI/226-388  AC B0VFI4.1
#=GS A1KYB1_TOBAC/234-397  AC A1KYB1.1
#=GS F3GDG6_PSESJ/199-381  AC F3GDG6.1
#=GS H3DMF5_TETNG/358-519  AC H3DMF5.1
#=GS G3JMA0_CORMM/194-355  AC G3JMA0.1
#=GS H3KHF7_9BURK/227-386  AC H3KHF7.1
#=GS F3S6I3_9PROT/192-351  AC F3S6I3.1
#=GS D7HUC8_PSESS/199-381  AC D7HUC8.1
#=GS SAHH_XYLFM/238-400    AC B0U232.1
#=GS B4JLP1_DROGR/193-354  AC B4JLP1.1
#=GS D7BVH1_STRBB/243-405  AC D7BVH1.1
#=GS H0QUL7_9ACTO/249-411  AC H0QUL7.1
#=GS G4DT12_9GAMM/229-388  AC G4DT12.1
#=GS B1S6C4_9BIFI/253-412  AC B1S6C4.1
#=GS C9RQQ0_FIBSS/235-397  AC C9RQQ0.1
#=GS D1YY94_METPS/185-346  AC D1YY94.1
#=GS F2G3J7_ALTMD/173-329  AC F2G3J7.1
#=GS G8SPH2_BRUCA/227-386  AC G8SPH2.1
#=GS B6BS13_9PROT/189-348  AC B6BS13.1
#=GS E3J3F3_FRASU/236-398  AC E3J3F3.1
#=GS F5J6U6_9RHIZ/227-386  AC F5J6U6.1
#=GS Q42939_NICSY/205-368  AC Q42939.1
#=GS D3F6X2_CONWI/243-405  AC D3F6X2.1
#=GS A8EH18_BURPE/234-393  AC A8EH18.1
#=GS C5E811_BIFLI/205-364  AC C5E811.1
#=GS E2VMD3_MYCTU/253-415  AC E2VMD3.1
#=GS F2IAQ7_FLUTR/196-357  AC F2IAQ7.1
#=GS F8WW17_9PORP/232-394  AC F8WW17.1
#=GS E6QKI5_9ZZZZ/100-262  AC E6QKI5.1
#=GS D0A8F7_TRYB9/190-351  AC D0A8F7.1
#=GS Q5GW69_XANOR/269-431  AC Q5GW69.1
#=GS H9ES33_MACMU/191-352  AC H9ES33.1
#=GS B6C4R8_9GAMM/198-357  AC B6C4R8.1
#=GS E8QYE5_ISOPI/223-384  AC E8QYE5.1
#=GS G0CDE1_XANCA/238-400  AC G0CDE1.1
#=GS D9U9X7_VOMUR/7-24     AC D9U9X7.1
#=GS D5X3Y2_THIK1/233-392  AC D5X3Y2.1
#=GS D9XWV4_9ACTO/185-347  AC D9XWV4.1
#=GS G8BTW7_TETPH/194-355  AC G8BTW7.1
#=GS D1F5M8_BRUML/227-386  AC D1F5M8.1
#=GS F7SYS4_ALCXX/232-391  AC F7SYS4.1
#=GS D9U9X4_PSEPE/7-24     AC D9U9X4.1
#=GS Q2XTD0_SOLTU/240-402  AC Q2XTD0.1
#=GS H2S9L1_TAKRU/296-457  AC H2S9L1.1
#=GS C7D8T2_9RHOB/190-350  AC C7D8T2.1
#=GS G8ZUA3_TORDC/194-355  AC G8ZUA3.1
#=GS B0XQD2_ASPFC/194-355  AC B0XQD2.1
#=GS E5XRG6_9ACTO/248-410  AC E5XRG6.1
#=GS D4JRW5_9FIRM/183-344  AC D4JRW5.1
#=GS D6CXV6_9BACE/236-398  AC D6CXV6.1
#=GS F7M4M7_9BACE/232-394  AC F7M4M7.1
#=GS Q803T5_DANRE/192-353  AC Q803T5.1
#=GS C5T5U8_ACIDE/237-397  AC C5T5U8.1
#=GS F6QYU4_XENTR/282-443  AC F6QYU4.1
#=GS H0BRG1_9ACTO/243-405  AC H0BRG1.1
#=GS G8YT10_PICSO/194-355  AC G8YT10.1
#=GS C0XV60_9CORY/257-419  AC C0XV60.1
#=GS H3ZJS3_THELI/188-349  AC H3ZJS3.1
#=GS I1LN30_SOYBN/240-403  AC I1LN30.1
#=GS I0XQH5_9LEPT/197-359  AC I0XQH5.1
#=GS A2E342_TRIVA/244-406  AC A2E342.1
#=GS SAHH_PSEA8/199-381    AC B7V419.1
#=GS F2VCH8_MYCTU/253-415  AC F2VCH8.1
#=GS C4FQS7_9FIRM/184-345  AC C4FQS7.1
#=GS H3PG55_BRUAO/227-386  AC H3PG55.1
#=GS A8ILJ5_AZOC5/238-397  AC A8ILJ5.1
#=GS G9PY56_9BACT/186-347  AC G9PY56.1
#=GS A3JC12_9ALTE/200-376  AC A3JC12.1
#=GS F1TH87_9CLOT/184-345  AC F1TH87.1
#=GS I0RWH8_MYCXE/248-410  AC I0RWH8.1
#=GS F5K105_PSEAI/199-381  AC F5K105.1
#=GS SAHH_AQUAE/185-346    AC O67240.1
#=GS SAHH_BRAJA/232-391    AC Q89HP6.1
#=GS B7J553_ACIF2/193-377  AC B7J553.1
#=GS D3F928_CONWI/241-403  AC D3F928.1
#=GS B2IVA4_NOSP7/192-353  AC B2IVA4.1
#=GS F2U121_SALS5/192-353  AC F2U121.1
#=GS Q5BDW7_EMENI/194-355  AC Q5BDW7.1
#=GS H0XG49_OTOGA/191-352  AC H0XG49.1
#=GS Q2Y5Z2_NITMU/240-399  AC Q2Y5Z2.1
#=GS H3DAX8_TETNG/309-470  AC H3DAX8.1
#=GS D9ZCH9_9CARY/1-123    AC D9ZCH9.1
#=GS D9U9W2_METNU/7-24     AC D9U9W2.1
#=GS I0DJ33_CORPS/237-399  AC I0DJ33.1
#=GS G0AE01_COLFT/236-395  AC G0AE01.1
#=GS E2C5J6_HARSA/287-448  AC E2C5J6.1
#=GS D3BNY4_POLPA/194-354  AC D3BNY4.1
#=GS H0E836_9ACTN/201-362  AC H0E836.1
#=GS SAHH_PYRHO/188-349    AC O58275.2
#=GS A9WGQ4_CHLAA/187-348  AC A9WGQ4.1
#=GS E2WM36_MYCTU/253-415  AC E2WM36.1
#=GS H2TA78_TAKRU/289-450  AC H2TA78.1
#=GS B7GZN8_ACIB3/197-372  AC B7GZN8.1
#=GS E1Z174_9BACE/232-394  AC E1Z174.1
#=GS A8UUD2_9AQUI/185-346  AC A8UUD2.1
#=GS A2ZDY4_ORYSI/240-403  AC A2ZDY4.1
#=GS C4YRU3_CANAW/195-356  AC C4YRU3.1
#=GS G4ITU8_9RHIZ/230-389  AC G4ITU8.1
#=GS A4KLE5_MYCTU/253-415  AC A4KLE5.1
#=GS Q1MKZ8_RHIL3/168-331  AC Q1MKZ8.1
#=GS B2Q253_PROST/185-346  AC B2Q253.1
#=GS F8WI65_MOUSE/267-428  AC F8WI65.1
#=GS Q9BTL0_HUMAN/1-119    AC Q9BTL0.2
#=GS SAHH_MYCLE/250-412    AC Q9CCJ4.1
#=GS A1B5H5_PARDP/224-383  AC A1B5H5.1
#=GS C0PHR4_MAIZE/240-403  AC C0PHR4.1
#=GS H6N060_GORPV/251-412  AC H6N060.1
#=GS D9N155_HUMAN/267-428  AC D9N155.1
#=GS E6N5M0_9ARCH/202-363  AC E6N5M0.1
#=GS H1MRS0_9PLAN/234-393  AC H1MRS0.1
#=GS SAHH_STRGG/243-405    AC B1VUW6.1
#=GS A7LW20_BACOV/236-398  AC A7LW20.1
#=GS SAHH_DESVM/238-400    AC B8DR41.1
#=GS D7W701_9FLAO/196-357  AC D7W701.1
#=GS D5QR03_METTR/229-388  AC D5QR03.1
#=GS C8RQX2_CORJE/233-399  AC C8RQX2.1
#=GS B4HTG3_DROSE/280-441  AC B4HTG3.1
#=GS H2P1P8_PONAB/191-352  AC H2P1P8.1
#=GS D5VH82_CAUST/224-383  AC D5VH82.1
#=GS F7RZA6_9GAMM/193-369  AC F7RZA6.1
#=GS D1BMM1_VEIPT/184-345  AC D1BMM1.1
#=GS F9N3W6_9FIRM/184-345  AC F9N3W6.1
#=GS E2SWT6_9RALS/231-390  AC E2SWT6.1
#=GS G6X082_CORGT/236-398  AC G6X082.1
#=GS SAHH_CUPNH/231-390    AC Q0KF25.1
#=GS Q12WS2_METBU/181-341  AC Q12WS2.1
#=GS H6RKW6_BLASD/253-415  AC H6RKW6.1
#=GS Q2BJQ0_9GAMM/161-319  AC Q2BJQ0.1
#=GS B4QWE4_DROSI/252-413  AC B4QWE4.1
#=GS F3NRR0_9ACTO/243-405  AC F3NRR0.1
#=GS B3L654_PLAKH/233-395  AC B3L654.1
#=GS F7UQ40_SYNYG/192-353  AC F7UQ40.1
#=GS A7RME1_NEMVE/194-354  AC A7RME1.1
#=GS F2IVA0_POLGS/223-382  AC F2IVA0.1
#=GS B7S0R1_9GAMM/199-375  AC B7S0R1.1
#=GS D7EUB8_MYCTU/253-415  AC D7EUB8.1
#=GS F1QNI0_DANRE/275-436  AC F1QNI0.1
#=GS Q46II6_PROMT/238-397  AC Q46II6.1
#=GS D7EIK6_TRICA/163-324  AC D7EIK6.1
#=GS F8AYT8_FRADG/189-351  AC F8AYT8.1
#=GS B7QU21_9RHOB/227-386  AC B7QU21.1
#=GS Q179S1_AEDAE/218-381  AC Q179S1.1
#=GS D3DFI8_HYDTT/185-346  AC D3DFI8.1
#=GS B0TAW7_HELMI/184-345  AC B0TAW7.1
#=GS F5LD25_9BACL/188-349  AC F5LD25.1
#=GS D1FGU8_9RHIZ/227-386  AC D1FGU8.1
#=GS F8XTS9_9GAMM/196-380  AC F8XTS9.1
#=GS B8HYQ8_CYAP4/195-356  AC B8HYQ8.1
#=GS Q67NR1_SYMTH/190-351  AC Q67NR1.1
#=GS G8TIZ6_NIAKG/200-361  AC G8TIZ6.1
#=GS E7KBQ1_YEASA/194-355  AC E7KBQ1.1
#=GS A9RP25_PHYPA/240-403  AC A9RP25.1
#=GS G0GAZ7_9SPIO/229-391  AC G0GAZ7.1
#=GS F6AR48_DELSC/236-395  AC F6AR48.1
#=GS Q5KJ87_CRYNJ/190-351  AC Q5KJ87.1
#=GS B5SEK1_RALSL/231-390  AC B5SEK1.1
#=GS B6YX87_THEON/188-349  AC B6YX87.1
#=GS C0BKL8_9BACT/1-46     AC C0BKL8.1
#=GS F3IDG4_PSESL/169-256  AC F3IDG4.1
#=GS Q7S9Y8_NEUCR/194-355  AC Q7S9Y8.1
#=GS B1GYL0_UNCTG/198-359  AC B1GYL0.1
#=GS A7TQS1_VANPO/194-355  AC A7TQS1.1
#=GS D1JW86_9BACE/247-409  AC D1JW86.1
#=GS A6C2T7_9PLAN/201-363  AC A6C2T7.1
#=GS A8H827_SHEPA/193-353  AC A8H827.1
#=GS SAHH_HAHCH/199-375    AC Q2SLT4.1
#=GS SAHH_MYCBP/253-415    AC A1KNQ0.1
#=GS G6H9S7_9ACTO/236-398  AC G6H9S7.1
#=GS C4ITT2_BRUAO/242-401  AC C4ITT2.1
#=GS E0VN64_PEDHC/308-469  AC E0VN64.1
#=GS Q03MD2_STRTD/347-494  AC Q03MD2.1
#=GS Q5N3M4_SYNP6/193-354  AC Q5N3M4.1
#=GS H3PX91_BRUAO/227-386  AC H3PX91.1
#=GS D9U9X6_MACRO/7-24     AC D9U9X6.1
#=GS H2CLR3_9LEPT/193-355  AC H2CLR3.1
#=GS A0Z2Q7_9GAMM/199-375  AC A0Z2Q7.1
#=GS F4G229_METCR/182-343  AC F4G229.1
#=GS Q8BPI7_MOUSE/83-244   AC Q8BPI7.1
#=GS D7DTY9_METV3/183-343  AC D7DTY9.1
#=GS A1TLW0_ACIAC/176-324  AC A1TLW0.1
#=GS D8K184_DEHLB/186-347  AC D8K184.1
#=GS F5THT8_9FIRM/184-345  AC F5THT8.1
#=GS F3I2A9_PSESF/169-256  AC F3I2A9.1
#=GS Q9XF45_GOSHI/1-102    AC Q9XF45.1
#=GS C8W590_DESAS/185-346  AC C8W590.1
#=GS G0BH35_9ENTR/175-324  AC G0BH35.1
#=GS B0RG39_CLAMS/313-425  AC B0RG39.1
#=GS G2IXB8_PSEUL/231-390  AC G2IXB8.1
#=GS SAHH_HYPNA/230-389    AC Q0C427.1
#=GS D0CM12_9SYNE/237-396  AC D0CM12.1
#=GS F0RE81_CELLC/197-358  AC F0RE81.1
#=GS A4WWT6_RHOS5/224-383  AC A4WWT6.1
#=GS A7E7B4_SCLS1/194-355  AC A7E7B4.1
#=GS G8GJ68_LINUS/316-479  AC G8GJ68.1
#=GS F0Q3G4_ACIAP/235-394  AC F0Q3G4.1
#=GS G0IXL8_CYCMS/198-359  AC G0IXL8.1
#=GS SAHH_SULSO/184-345    AC P50252.1
#=GS D5ZLC7_MYCTU/253-415  AC D5ZLC7.1
#=GS SAHH_POLNS/235-399    AC B1XSH8.1
#=GS H5XDS3_9PSEU/255-417  AC H5XDS3.1
#=GS B8L0Q0_9GAMM/239-401  AC B8L0Q0.1
#=GS Q5D6C3_ARATH/240-403  AC Q5D6C3.1
#=GS C1B1D5_RHOOB/243-405  AC C1B1D5.1
#=GS Q9M4V0_LUPLU/37-90    AC Q9M4V0.1
#=GS B8D650_DESK1/189-351  AC B8D650.1
#=GS D0GCF8_BRUML/227-386  AC D0GCF8.1
#=GS F7KLR2_9FIRM/184-345  AC F7KLR2.1
#=GS D3E0I6_METRM/183-344  AC D3E0I6.1
#=GS D6PJJ7_9ZZZZ/191-352  AC D6PJJ7.1
#=GS A0NUU4_9RHOB/223-382  AC A0NUU4.1
#=GS C7N784_SLAHD/183-344  AC C7N784.1
#=GS G5HUH1_9CLOT/134-269  AC G5HUH1.1
#=GS E5YUE5_9BACL/190-351  AC E5YUE5.1
#=GS A4TF84_MYCGI/244-406  AC A4TF84.1
#=GS F4XNE8_9CYAN/192-353  AC F4XNE8.1
#=GS A1SGL1_NOCSJ/234-396  AC A1SGL1.1
#=GS E3DN53_HALPG/186-347  AC E3DN53.1
#=GS H6L1E3_SAPGL/195-356  AC H6L1E3.1
#=GS Q6YBX8_CRYPV/244-407  AC Q6YBX8.1
#=GS SAHH2_MOUSE/289-450   AC Q80SW1.1
#=GS E6PIR7_9ZZZZ/190-351  AC E6PIR7.1
#=GS E6X5N7_CELAD/197-358  AC E6X5N7.1
#=GS B4KVE3_DROMO/281-442  AC B4KVE3.1
#=GS C5LS97_PERM5/118-282  AC C5LS97.1
#=GS SAHH_MYXXD/236-395    AC Q1CY84.1
#=GS SAHH_DROME/191-352    AC Q27580.2
#=GS SAHH_CHRVO/227-386    AC Q7NZF7.1
#=GS B8EJV3_METSB/229-388  AC B8EJV3.1
#=GS H2N6G7_PONAB/289-450  AC H2N6G7.1
#=GS H5S215_9NOCA/242-404  AC H5S215.1
#=GS SAHH_METPB/229-388    AC B1ZLX0.1
#=GS E7MZH2_9FIRM/185-346  AC E7MZH2.1
#=GS D8QDU8_SCHCM/189-350  AC D8QDU8.1
#=GS B9WHX7_CANDC/195-356  AC B9WHX7.1
#=GS H3BIH4_LATCH/202-363  AC H3BIH4.1
#=GS A0QKB5_MYCA1/254-416  AC A0QKB5.1
#=GS I0E040_PROST/185-346  AC I0E040.1
#=GS B8LNU2_PICSI/240-403  AC B8LNU2.1
#=GS B4CZK1_9BACT/234-396  AC B4CZK1.1
#=GS SAHH_PELLD/231-393    AC Q3B532.1
#=GS D1AF41_THECD/234-396  AC D1AF41.1
#=GS B1XI71_SYNP2/197-372  AC B1XI71.1
#=GS SAHH_BACFR/247-409    AC Q64MT2.1
#=GS Q5M9P0_MOUSE/191-352  AC Q5M9P0.1
#=GS Q2R4Y8_ORYSJ/205-368  AC Q2R4Y8.1
#=GS H3II34_STRPU/191-351  AC H3II34.1
#=GS E9V3F4_9ACTO/237-399  AC E9V3F4.1
#=GS C5DLJ4_LACTC/194-355  AC C5DLJ4.1
#=GS E8L542_9RHIZ/230-389  AC E8L542.1
#=GS SAHH_SYNS3/237-396    AC Q0IDX7.1
#=GS A5FRV3_DEHSB/185-346  AC A5FRV3.1
#=GS F0BCH9_9XANT/238-400  AC F0BCH9.1
#=GS D8J600_HALJB/194-355  AC D8J600.1
#=GS C0NJC3_AJECG/194-355  AC C0NJC3.1
#=GS F1Z9Q4_9SPHN/227-386  AC F1Z9Q4.1
#=GS Q5C0M4_SCHJA/178-237  AC Q5C0M4.2
#=GS D9TC12_MICAI/257-419  AC D9TC12.1
#=GS G1SXT1_RABIT/321-482  AC G1SXT1.1
#=GS B1YR53_BURA4/233-392  AC B1YR53.1
#=GS A4BD38_9GAMM/196-372  AC A4BD38.1
#=GS SAHH_RHOPT/230-389    AC B3QJT3.1
#=GS D9UI52_9ACTO/167-323  AC D9UI52.1
#=GS A1CQA2_ASPCL/194-355  AC A1CQA2.1
#=GS A1ZP39_9BACT/195-356  AC A1ZP39.1
#=GS SAHH_XYLFA/238-400    AC Q9PEJ1.2
#=GS SAHH_BRUAB/227-386    AC Q57AG3.1
#=GS A7BWL7_9GAMM/198-357  AC A7BWL7.1
#=GS F1S612_PIG/256-350    AC F1S612.1
#=GS F9J8F6_ACIBA/197-372  AC F9J8F6.1
#=GS G3LPD9_9BRAS/1-124    AC G3LPD9.1
#=GS B3RUN3_TRIAD/216-377  AC B3RUN3.1
#=GS SAHH_MYCBT/253-415    AC C1AH22.1
#=GS D1CC76_THET1/187-348  AC D1CC76.1
#=GS G3SWB5_LOXAF/370-531  AC G3SWB5.1
#=GS C4JQU5_UNCRE/194-355  AC C4JQU5.1
#=GS B7DM77_9BACL/188-349  AC B7DM77.1
#=GS G1KM02_ANOCA/267-428  AC G1KM02.1
#=GS G0HF72_CORVD/258-424  AC G0HF72.1
#=GS H0GTU3_9SACH/194-355  AC H0GTU3.1
#=GS F7DN19_CALJA/180-324  AC F7DN19.1
#=GS E3A600_PSEAI/199-381  AC E3A600.1
#=GS F8DBC0_HALXS/198-359  AC F8DBC0.1
#=GS E0NWJ5_9FIRM/187-348  AC E0NWJ5.1
#=GS SAHH_RHILW/227-386    AC B5ZV80.1
#=GS D4MKA1_9FIRM/183-344  AC D4MKA1.1
#=GS B6A910_CRYMR/242-405  AC B6A910.1
#=GS SAHH_PELPB/231-393    AC B4SD43.1
#=GS D0LME3_HALO1/186-347  AC D0LME3.1
#=GS SAHH_BURP8/234-393    AC B2JIP4.1
#=GS H2L3V8_ORYLA/290-451  AC H2L3V8.1
#=GS C1GWG4_PARBA/194-355  AC C1GWG4.1
#=GS A7TDI6_NEMVE/197-269  AC A7TDI6.1
#=GS G8UTV2_LEGPN/202-361  AC G8UTV2.1
#=GS D0G0C3_PIG/191-352    AC D0G0C3.1
#=GS B4WP04_9SYNE/206-382  AC B4WP04.1
#=GS C6DXJ4_MYCTK/253-415  AC C6DXJ4.1
#=GS A9RPH2_PHYPA/240-403  AC A9RPH2.1
#=GS A3DEQ3_CLOTH/184-345  AC A3DEQ3.1
#=GS G8Q2K3_PSEFL/199-381  AC G8Q2K3.1
#=GS A6E4P9_9RHOB/223-382  AC A6E4P9.1
#=GS SAHH_CHLL2/231-393    AC B3EDY3.1
#=GS SAHH_BOVIN/191-352    AC Q3MHL4.3
#=GS A4FNJ5_SACEN/245-407  AC A4FNJ5.1
#=GS F1LHA5_ASCSU/24-73    AC F1LHA5.1
#=GS A0NUN9_9RHOB/172-329  AC A0NUN9.1
#=GS D1EPE3_9RHIZ/227-386  AC D1EPE3.1
#=GS F1X635_MORCA/208-381  AC F1X635.1
#=GS A8IXE0_CHLRE/239-401  AC A8IXE0.1
#=GS I0PKY7_MYCAB/244-406  AC I0PKY7.1
#=GS F6EFW8_AMYSD/248-410  AC F6EFW8.1
#=GS C3ZBK6_BRAFL/194-354  AC C3ZBK6.1
#=GS H2HHH2_CORDP/236-398  AC H2HHH2.1
#=GS F7GHP8_MONDO/1-108    AC F7GHP8.1
#=GS Q1YFB2_MOBAS/227-386  AC Q1YFB2.1
#=GS A6DH91_9BACT/227-395  AC A6DH91.1
#=GS SAHH_PELCD/233-395    AC Q3A392.1
#=GS A9AYL4_HERA2/187-348  AC A9AYL4.1
#=GS F8C4Q3_THESO/185-346  AC F8C4Q3.1
#=GS F2PX12_TRIEC/194-346  AC F2PX12.1
#=GS A7H6N3_ANADF/251-413  AC A7H6N3.1
#=GS E4Y0A0_OIKDI/226-387  AC E4Y0A0.1
#=GS E9EHI9_METAQ/194-355  AC E9EHI9.1
#=GS Q4WT91_ASPFU/194-355  AC Q4WT91.1
#=GS G3UI00_LOXAF/249-410  AC G3UI00.1
#=GS B2VTN4_PYRTR/194-355  AC B2VTN4.1
#=GS G8T1H0_BRUAO/227-386  AC G8T1H0.1
#=GS SAHH_PLACH/234-396    AC Q4XZZ5.1
#=GS SAHH_PROMP/233-392    AC Q7UZN3.1
#=GS C1BVW3_9MAXI/191-352  AC C1BVW3.1
#=GS G7VPX3_PAETH/190-351  AC G7VPX3.1
#=GS A7XB47_BRAOA/240-403  AC A7XB47.1
#=GS Q1MQK3_LAWIP/237-399  AC Q1MQK3.1
#=GS E8MM25_BIFLS/261-420  AC E8MM25.1
#=GS SAHH_ACISJ/235-395    AC A1W3P0.1
#=GS A0JU72_ARTS2/240-406  AC A0JU72.1
#=GS D7MH99_ARALL/240-403  AC D7MH99.1
#=GS E1QFH0_DESB2/236-398  AC E1QFH0.1
#=GS A9ZGE9_COXBE/195-354  AC A9ZGE9.1
#=GS H0RQB1_9BRAD/232-391  AC H0RQB1.1
#=GS H7E1Y9_9FIRM/184-345  AC H7E1Y9.1
#=GS A5UQK9_ROSS1/198-359  AC A5UQK9.1
#=GS SAHH_BRUSI/227-386    AC B0CJJ7.1
#=GS F6R1A5_CALJA/370-531  AC F6R1A5.1
#=GS Q5CBH0_9THEM/183-344  AC Q5CBH0.1
#=GS H1NPY4_9SPHI/201-362  AC H1NPY4.1
#=GS B1WRZ2_CYAA5/192-353  AC B1WRZ2.1
#=GS A9PIA2_POPTR/240-403  AC A9PIA2.1
#=GS A4ETK6_9RHOB/222-381  AC A4ETK6.1
#=GS D8M5F5_BLAHO/225-387  AC D8M5F5.1
#=GS SAHH_SYNS9/237-396    AC Q3B0K7.1
#=GS E7L064_TRYCR/190-351  AC E7L064.1
#=GS C5E4V4_ZYGRC/194-355  AC C5E4V4.1
#=GS E2MAH1_PSEUB/169-256  AC E2MAH1.1
#=GS SAHH_BART1/226-385    AC A9IL83.1
#=GS B4HA69_DROPE/245-406  AC B4HA69.1
#=GS H2HPU1_CORDP/236-398  AC H2HPU1.1
#=GS SAHH_CHLPD/231-393    AC A1BEZ2.1
#=GS D9U9X5_TRIVU/7-24     AC D9U9X5.1
#=GS D0LJJ9_HALO1/258-432  AC D0LJJ9.1
#=GS F6BQE4_SINMB/227-386  AC F6BQE4.1
#=GS F0IXV6_ACIMA/195-354  AC F0IXV6.1
#=GS A6VFL1_METM7/183-343  AC A6VFL1.1
#=GS C5GK39_AJEDR/194-355  AC C5GK39.1
#=GS SAHH_BRUO2/227-386    AC A5VT52.1
#=GS D8VME0_9NEOP/53-213   AC D8VME0.1
#=GS SAHH_BURPP/234-393    AC B2T6X2.1
#=GS F0NKE4_SULIH/203-364  AC F0NKE4.1
#=GS SAHH_DESVV/238-400    AC A1VFZ7.1
#=GS G1SVH0_RABIT/193-354  AC G1SVH0.1
#=GS F2SA23_TRIT1/194-355  AC F2SA23.1
#=GS E0Y047_9GAMM/192-368  AC E0Y047.1
#=GS Q39KN9_BURS3/233-392  AC Q39KN9.1
#=GS A1T5W9_MYCVP/244-405  AC A1T5W9.1
#=GS G9A494_RHIFH/227-386  AC G9A494.1
#=GS F8MHK4_NEUT8/194-355  AC F8MHK4.1
#=GS D3ZWL6_RAT/372-533    AC D3ZWL6.1
#=GS B5VHH7_YEAS6/194-355  AC B5VHH7.1
#=GS G6F1E0_9PROT/192-351  AC G6F1E0.1
#=GS F2I015_PELSM/196-355  AC F2I015.1
#=GS F8LDH5_9CHLA/197-360  AC F8LDH5.1
#=GS F4C0U1_METCG/181-342  AC F4C0U1.1
#=GS A0LF64_SYNFM/185-346  AC A0LF64.1
#=GS A7TUS0_STRLI/169-327  AC A7TUS0.1
#=GS A2BZ10_PROM5/240-399  AC A2BZ10.1
#=GS B4MSP6_DROWI/191-352  AC B4MSP6.1
#=GS E8NG31_MICTS/78-183   AC E8NG31.1
#=GS F7LVJ6_9BACE/232-394  AC F7LVJ6.1
#=GS H3MZE2_KLEOX/177-326  AC H3MZE2.1
#=GS G1UV90_9DELT/233-395  AC G1UV90.1
#=GS C6HUM4_9BACT/185-346  AC C6HUM4.1
#=GS C8WCY6_ZYMMN/225-384  AC C8WCY6.1
#=GS F1WX35_MORCA/208-381  AC F1WX35.1
#=GS B8LW43_TALSN/194-355  AC B8LW43.1
#=GS A8XGI1_CAEBR/193-354  AC A8XGI1.1
#=GS D8VMC0_9NEOP/53-213   AC D8VMC0.1
#=GS E3F7F3_CORP9/237-399  AC E3F7F3.1
#=GS Q1BRM3_BURCA/233-392  AC Q1BRM3.1
#=GS Q006P2_9ASTR/82-245   AC Q006P2.1
#=GS Q0D1M1_ASPTN/185-343  AC Q0D1M1.1
#=GS C0Z3F3_ARATH/46-209   AC C0Z3F3.1
#=GS H9UAH2_FERPE/179-339  AC H9UAH2.1
#=GS A3XQ70_LEEBM/197-358  AC A3XQ70.1
#=GS E1NE31_9BIFI/253-412  AC E1NE31.1
#=GS SAHH_MYCMM/250-412    AC B2HEP6.1
#=GS D5X8M7_THEPJ/186-347  AC D5X8M7.1
#=GS B9AG57_METSM/183-344  AC B9AG57.1
#=GS B5WH84_9BURK/233-392  AC B5WH84.1
#=GS D6GAX0_9ENTR/177-326  AC D6GAX0.1
#=GS E8N5C9_ANATU/186-347  AC E8N5C9.1
#=GS A8PRQ4_MALGO/190-351  AC A8PRQ4.1
#=GS G0VRR5_MEGEL/184-345  AC G0VRR5.1
#=GS Q062T0_9SYNE/237-396  AC Q062T0.1
#=GS H0IEB6_9MYCO/249-411  AC H0IEB6.1
#=GS B1LXI6_METRJ/227-386  AC B1LXI6.1
#=GS H8MXV8_CORCM/236-395  AC H8MXV8.1
#=GS A3V279_9RHOB/223-382  AC A3V279.1
#=GS D2Q8L2_BIFDB/253-412  AC D2Q8L2.1
#=GS A9CUW7_9RHIZ/225-384  AC A9CUW7.1
#=GS D0TL66_9BACE/236-398  AC D0TL66.1
#=GS Q4LB19_HORVU/240-403  AC Q4LB19.1
#=GS E4LJ32_9FIRM/185-346  AC E4LJ32.1
#=GS D2BH08_DEHSV/185-346  AC D2BH08.1
#=GS A2BLV8_HYPBU/186-347  AC A2BLV8.1
#=GS Q6AZU3_XENLA/342-503  AC Q6AZU3.1
#=GS B4V6E9_9ACTO/31-193   AC B4V6E9.1
#=GS C0BLG9_9BACT/197-358  AC C0BLG9.1
#=GS E5XTP4_9ACTO/6-69     AC E5XTP4.1
#=GS E4TFL4_CALNY/225-387  AC E4TFL4.1
#=GS A6UUT6_META3/189-349  AC A6UUT6.1
#=GS F7E7P0_MONDO/268-429  AC F7E7P0.1
#=GS G0E2N0_ENTAK/160-309  AC G0E2N0.1
#=GS H3LA17_KLEOX/177-326  AC H3LA17.1
#=GS H0JFU1_9PSED/199-380  AC H0JFU1.1
#=GS B0VBQ2_ACIBY/197-372  AC B0VBQ2.1
#=GS D2R0T0_PIRSD/196-361  AC D2R0T0.1
#=GS B7CV58_BURPE/234-393  AC B7CV58.1
#=GS E3LMU2_CAERE/193-354  AC E3LMU2.1
#=GS D7A3L9_STAND/229-388  AC D7A3L9.1
#=GS E4RQY6_LEAB4/196-357  AC E4RQY6.1
#=GS E8TBF2_MESCW/227-386  AC E8TBF2.1
#=GS D5BW57_NITHN/198-357  AC D5BW57.1
#=GS SAHH_BRUA1/227-386    AC B2S994.1
#=GS G2PTM1_9FIRM/185-346  AC G2PTM1.1
#=GS SAHH_RHIME/227-386    AC Q92TC1.1
#=GS H3DQL1_TETNG/1-89     AC H3DQL1.1
#=GS E3B8C9_9MICO/236-402  AC E3B8C9.1
#=GS F6D5J6_METSW/184-345  AC F6D5J6.1
#=GS B3LS56_YEAS1/194-355  AC B3LS56.1
#=GS E3HP56_ACHXA/232-391  AC E3HP56.1
#=GS B7R1I7_9EURY/188-349  AC B7R1I7.1
#=GS B1X4M3_PAUCH/239-398  AC B1X4M3.1
#=GS E0DJJ4_9RHIZ/227-386  AC E0DJJ4.1
#=GS H0XVM6_OTOGA/194-355  AC H0XVM6.1
#=GS E0RTC2_SPITD/229-391  AC E0RTC2.1
#=GS E8PGQ0_ACIB1/197-372  AC E8PGQ0.1
#=GS SAHH_PROM4/237-396    AC A9BD69.1
#=GS A8LWV3_SALAI/254-416  AC A8LWV3.1
#=GS F0L2Z0_AGRSH/227-386  AC F0L2Z0.1
#=GS Q1V0V2_PELUQ/189-348  AC Q1V0V2.1
#=GS G1NUR5_MYOLU/174-335  AC G1NUR5.1
#=GS B8NIT1_ASPFN/194-355  AC B8NIT1.1
#=GS D6AHL8_STRFL/243-405  AC D6AHL8.1
#=GS F4CRV7_PSEUX/261-423  AC F4CRV7.1
#=GS Q28S15_JANSC/108-264  AC Q28S15.1
#=GS B9M9N2_GEOSF/225-384  AC B9M9N2.1
#=GS E1VQZ0_9GAMM/195-371  AC E1VQZ0.1
#=GS I1D4R2_9PSEU/243-405  AC I1D4R2.1
#=GS D5UW16_TSUPD/246-408  AC D5UW16.1
#=GS E6YJQ9_9RHIZ/226-385  AC E6YJQ9.1
#=GS A4U1X8_9PROT/224-383  AC A4U1X8.1
#=GS B4X3B1_9GAMM/198-374  AC B4X3B1.1
#=GS D9SB20_FIBSS/248-410  AC D9SB20.1
#=GS F2QV27_PICP7/190-351  AC F2QV27.1
#=GS H5WSQ6_9BURK/235-394  AC H5WSQ6.1
#=GS D0CSI4_9RHOB/227-386  AC D0CSI4.1
#=GS C8S126_9RHOB/225-384  AC C8S126.1
#=GS SAHH_PSEFS/199-381    AC C3K3G6.1
#=GS SAHH_HALWD/197-358    AC Q18EV6.1
#=GS SAHH_XANC5/238-400    AC Q3BXC6.1
#=GS D6EUY9_STRLI/243-405  AC D6EUY9.1
#=GS F6IG54_9SPHN/256-415  AC F6IG54.1
#=GS D7IEQ3_9BACE/236-398  AC D7IEQ3.1
#=GS D8SW83_SELML/240-403  AC D8SW83.1
#=GS C0S5I8_PARBP/194-355  AC C0S5I8.1
#=GS SAHH_XANAC/238-400    AC Q8PP84.1
#=GS I1FTP1_AMPQE/323-482  AC I1FTP1.1
#=GS D9ZCI3_9CARY/1-123    AC D9ZCI3.1
#=GS D1BET0_SANKS/167-329  AC D1BET0.1
#=GS G4IBR2_9EURY/192-353  AC G4IBR2.1
#=GS H9I638_ATTCE/192-352  AC H9I638.1
#=GS D9QHS5_BRESC/224-383  AC D9QHS5.1
#=GS D0RKR3_9RHIZ/227-386  AC D0RKR3.1
#=GS D9WK79_9ACTO/243-405  AC D9WK79.1
#=GS Q3AC62_CARHZ/183-344  AC Q3AC62.1
#=GS B9KZS4_THERP/189-350  AC B9KZS4.1
#=GS F3JXR3_PSESZ/199-381  AC F3JXR3.1
#=GS F5JQA7_ACIBA/197-372  AC F5JQA7.1
#=GS D7E8N1_METEZ/181-341  AC D7E8N1.1
#=GS A5G5V9_GEOUR/225-384  AC A5G5V9.1
#=GS F7ECC9_XENTR/349-510  AC F7ECC9.1
#=GS Q0GGS9_9FABA/166-193  AC Q0GGS9.1
#=GS B5S7I0_RALSL/231-390  AC B5S7I0.1
#=GS G3N7R2_GASAC/270-431  AC G3N7R2.1
#=GS B0JWW0_MICAN/192-353  AC B0JWW0.1
#=GS C7PCF1_CHIPD/201-362  AC C7PCF1.1
#=GS D6LM31_9RHIZ/242-401  AC D6LM31.1
#=GS C4LU18_ENTHI/226-388  AC C4LU18.1
#=GS SAHH_BURP6/234-393    AC A3NER1.1
#=GS SAHH_BORPE/232-391    AC Q7VUL8.1
#=GS B4M5K6_DROVI/248-409  AC B4M5K6.1
#=GS A4YYF0_BRASO/229-388  AC A4YYF0.1
#=GS E6YT83_9RHIZ/226-385  AC E6YT83.1
#=GS G4IY49_9PSEU/182-335  AC G4IY49.1
#=GS H1ULW5_ACEPA/189-348  AC H1ULW5.1
#=GS B6KEA5_TOXGO/232-395  AC B6KEA5.1
#=GS Q4N0H6_THEPA/245-409  AC Q4N0H6.1
#=GS D6KHU3_9FIRM/184-345  AC D6KHU3.1
#=GS C0N2W7_9GAMM/197-356  AC C0N2W7.1
#=GS G0VH98_NAUCC/194-355  AC G0VH98.1
#=GS F1NUT5_CHICK/242-403  AC F1NUT5.1
#=GS F1VP56_MORCA/208-381  AC F1VP56.1
#=GS H9Z708_MACMU/368-529  AC H9Z708.1
#=GS G7CP18_AERSA/167-321  AC G7CP18.1
#=GS G2FJ73_9GAMM/189-350  AC G2FJ73.1
#=GS G9NNI9_HYPAI/194-355  AC G9NNI9.1
#=GS C7KF72_ACEPA/189-348  AC C7KF72.1
#=GS A5HML4_CHRMO/240-403  AC A5HML4.1
#=GS A3MX37_PYRCJ/204-366  AC A3MX37.1
#=GS D0T2D3_ACIRA/197-372  AC D0T2D3.1
#=GS E0MM89_9RHOB/224-383  AC E0MM89.1
#=GS C4WKN8_9RHIZ/274-433  AC C4WKN8.1
#=GS G4ULT1_NEUT9/194-355  AC G4ULT1.1
#=GS G6DPS7_DANPL/190-350  AC G6DPS7.1
#=GS D4XP95_ACIHA/197-372  AC D4XP95.1
#=GS Q1HQR0_AEDAE/191-352  AC Q1HQR0.1
#=GS Q5UYR1_HALMA/190-351  AC Q5UYR1.1
#=GS A0YRG2_LYNSP/192-353  AC A0YRG2.1
#=GS I0HLF7_RUBGE/237-397  AC I0HLF7.1
#=GS G4ZRS7_PHYSP/238-398  AC G4ZRS7.1
#=GS C8X588_DESRD/233-395  AC C8X588.1
#=GS SAHH_NOCFA/252-414    AC Q5YQS7.1
#=GS G8PNY6_PSEUV/157-319  AC G8PNY6.1
#=GS I1K3S5_SOYBN/240-403  AC I1K3S5.1
#=GS F5SMY4_9GAMM/230-406  AC F5SMY4.1
#=GS H3IU57_STRPU/297-458  AC H3IU57.1
#=GS SAHH_HALWC/197-358    AC G0LFB0.1
#=GS D9Q1Q1_ACIS3/184-345  AC D9Q1Q1.1
#=GS F6DTJ0_DESRL/185-346  AC F6DTJ0.1
#=GS F9VZM9_9ACTO/250-411  AC F9VZM9.1
#=GS SAHH_RALPJ/231-390    AC B2U774.1
#=GS H2KNW6_CLOSI/327-488  AC H2KNW6.1
#=GS Q0PWS0_PIMPR/46-207   AC Q0PWS0.1
#=GS Q3J7R4_NITOC/198-357  AC Q3J7R4.1
#=GS F3DTL1_9PSED/167-256  AC F3DTL1.1
#=GS A5XRD0_BURML/234-393  AC A5XRD0.1
#=GS F3YYZ8_DESAF/234-397  AC F3YYZ8.1
#=GS Q2J5K2_FRASC/183-344  AC Q2J5K2.1
#=GS A4HPQ9_LEIBR/190-351  AC A4HPQ9.1
#=GS B7RKT6_9RHOB/229-388  AC B7RKT6.1
#=GS B9S9Y6_RICCO/240-403  AC B9S9Y6.1
#=GS H2Z7J2_CIOSA/243-404  AC H2Z7J2.1
#=GS B5JTS3_9GAMM/199-358  AC B5JTS3.1
#=GS H3TJM3_PSEAE/199-381  AC H3TJM3.1
#=GS G9R8I2_9ENTR/177-326  AC G9R8I2.1
#=GS A2VU71_9BURK/234-393  AC A2VU71.1
#=GS SAHH_PSEPW/199-381    AC B1J2Y8.1
#=GS B5GV76_STRCL/207-313  AC B5GV76.1
#=GS C7R7A8_KANKD/224-385  AC C7R7A8.1
#=GS E8S2T6_MICSL/257-419  AC E8S2T6.1
#=GS D4TTF9_9NOST/192-353  AC D4TTF9.1
#=GS F6CNK6_DESK7/185-346  AC F6CNK6.1
#=GS G0GKF2_KLEPN/185-334  AC G0GKF2.1
#=GS I0YKP7_9CHLO/244-406  AC I0YKP7.1
#=GS G2Z6H5_FLABF/198-359  AC G2Z6H5.1
#=GS C6RKC1_ACIRA/197-372  AC C6RKC1.1
#=GS B4N2Z9_DROWI/280-441  AC B4N2Z9.1
#=GS SAHH_RHIE6/227-386    AC B3PVW2.1
#=GS B7IEU3_THEAB/172-332  AC B7IEU3.1
#=GS D0B3Y6_BRUME/227-386  AC D0B3Y6.1
#=GS SAHH_MOUSE/191-352    AC P50247.3
#=GS E1NXX4_9LACO/183-331  AC E1NXX4.1
#=GS E9PV16_MOUSE/402-563  AC E9PV16.1
#=GS Q11XG9_CYTH3/194-355  AC Q11XG9.1
#=GS B5GDE7_9ACTO/244-406  AC B5GDE7.1
#=GS B9R0B9_9RHOB/266-425  AC B9R0B9.1
#=GS H6RBQ3_NOCCG/229-391  AC H6RBQ3.1
#=GS F7E2X5_MACMU/36-196   AC F7E2X5.1
#=GS H2LNS1_ORYLA/314-475  AC H2LNS1.1
#=GS B6BVG4_9PROT/250-409  AC B6BVG4.1
#=GS F3LI45_9GAMM/209-385  AC F3LI45.1
#=GS SAHH_PROM3/237-396    AC A2C620.1
#=GS G3SA81_GORGO/191-352  AC G3SA81.1
#=GS E1WRI9_BACF6/247-409  AC E1WRI9.1
#=GS I0PQI8_MYCAB/244-406  AC I0PQI8.1
#=GS F7L593_BACOV/232-394  AC F7L593.1
#=GS C1BS77_9MAXI/191-352  AC C1BS77.1
#=GS Q5CB69_THESQ/174-335  AC Q5CB69.1
#=GS Q2GZK1_CHAGB/194-355  AC Q2GZK1.1
#=GS A6GU53_9BURK/236-395  AC A6GU53.1
#=GS D3R859_KLEVT/177-326  AC D3R859.1
#=GS SAHH_PYRFU/188-349    AC P50251.2
#=GS C9LTR7_9FIRM/184-345  AC C9LTR7.1
#=GS A0Y9Q8_9GAMM/191-367  AC A0Y9Q8.1
#=GS D8IUM6_HERSS/229-388  AC D8IUM6.1
#=GS B9LBK0_CHLSY/187-348  AC B9LBK0.1
#=GS SAHH_PLAF7/235-397    AC P50250.2
#=GS SAHH_PLAF7/235-397    DR PDB; 1V8B B; 235-397;
#=GS SAHH_PLAF7/235-397    DR PDB; 1V8B A; 235-397;
#=GS SAHH_PLAF7/235-397    DR PDB; 1V8B C; 235-397;
#=GS SAHH_PLAF7/235-397    DR PDB; 1V8B D; 235-397;
#=GS B5GYY3_STRCL/243-405  AC B5GYY3.1
#=GS Q3TF14_MOUSE/191-352  AC Q3TF14.1
#=GS G1XZ50_9PROT/192-351  AC G1XZ50.1
#=GS F1LG91_ASCSU/65-197   AC F1LG91.1
#=GS F1P7I1_CANFA/283-444  AC F1P7I1.1
#=GS F7TWT1_BRELA/188-349  AC F7TWT1.1
#=GS C6NUC1_9GAMM/221-405  AC C6NUC1.1
#=GS Q6ZMI1_HUMAN/34-77    AC Q6ZMI1.1
#=GS E3BU65_9LACO/182-329  AC E3BU65.1
#=GS D7BBB9_MEISD/188-349  AC D7BBB9.1
#=GS H0A7B7_9PROT/194-353  AC H0A7B7.1
#=GS A3IKP2_9CHRO/192-353  AC A3IKP2.1
#=GS E3BVD7_9LACO/182-330  AC E3BVD7.1
#=GS SAHH_LEPBJ/196-358    AC Q04NN6.1
#=GS B5Y6W7_COPPD/183-344  AC B5Y6W7.1
#=GS A3WUA0_9BRAD/242-401  AC A3WUA0.1
#=GS Q0RAY6_FRAAA/225-387  AC Q0RAY6.1
#=GS C3YVA9_BRAFL/271-411  AC C3YVA9.1
#=GS C0PR38_PICSI/240-403  AC C0PR38.1
#=GS I0BP85_9BACL/135-261  AC I0BP85.1
#=GS A3LNU0_PICST/194-355  AC A3LNU0.1
#=GS A4CTK3_SYNPV/237-396  AC A4CTK3.1
#=GS H3QGS1_BRUAO/227-386  AC H3QGS1.1
#=GS D8P0Q5_RALSL/231-390  AC D8P0Q5.1
#=GS G2IIB2_9SPHN/226-385  AC G2IIB2.1
#=GS E9IY47_SOLIN/282-443  AC E9IY47.1
#=GS C5A8X1_BURGB/233-392  AC C5A8X1.1
#=GS B2A772_NATTJ/185-346  AC B2A772.1
#=GS B1G9E4_9BURK/234-393  AC B1G9E4.1
#=GS F3I9G3_PSESF/199-381  AC F3I9G3.1
#=GS I1G6K6_AMPQE/194-354  AC I1G6K6.1
#=GS F9TXA2_MARPU/229-388  AC F9TXA2.1
#=GS F0HM98_9ACTN/185-346  AC F0HM98.1
#=GS D6Z0B0_DESAT/196-355  AC D6Z0B0.1
#=GS SAHH_THEEB/196-357    AC Q8DGC8.1
#=GS F6S8G7_CALJA/292-452  AC F6S8G7.1
#=GS C9VV14_BRUAO/227-386  AC C9VV14.1
#=GS E4TS79_MARTH/193-353  AC E4TS79.1
#=GS D6Z9Z8_SEGRD/248-410  AC D6Z9Z8.1
#=GS B5EIK0_GEOBB/226-385  AC B5EIK0.1
#=GS H2MC29_ORYLA/192-353  AC H2MC29.1
#=GS A9GFA1_SORC5/198-360  AC A9GFA1.1
#=GS F8DWX1_ZYMMA/225-384  AC F8DWX1.1
#=GS D8HRL0_AMYMU/248-410  AC D8HRL0.1
#=GS F3ZDU3_9ACTO/244-406  AC F3ZDU3.1
#=GS D9TJE6_CALOO/185-346  AC D9TJE6.1
#=GS D9ZCI9_9CARY/1-123    AC D9ZCI9.1
#=GS F3D843_9PSED/199-381  AC F3D843.1
#=GS B0WMB4_CULQU/192-353  AC B0WMB4.1
#=GS Q0FV41_9RHOB/222-381  AC Q0FV41.1
#=GS G2ZNZ9_9RALS/231-390  AC G2ZNZ9.1
#=GS B3T9Q6_9ARCH/196-357  AC B3T9Q6.1
#=GS G8MAC2_9BURK/234-393  AC G8MAC2.1
#=GS SAHH_SULTO/182-343    AC Q975T0.1
#=GS H1KTL3_METEX/229-388  AC H1KTL3.1
#=GS A7IBQ2_XANP2/226-385  AC A7IBQ2.1
#=GS F1SMQ4_PIG/370-531    AC F1SMQ4.1
#=GS H0VRQ8_CAVPO/191-352  AC H0VRQ8.1
#=GS H2S0Z2_TAKRU/198-358  AC H2S0Z2.1
#=GS E1RFM0_METP4/175-334  AC E1RFM0.1
#=GS G7VE02_9CREN/206-368  AC G7VE02.1
#=GS Q4FT37_PSYA2/210-386  AC Q4FT37.1
#=GS A4XJI2_CALS8/183-344  AC A4XJI2.2
#=GS C0GHU9_9FIRM/183-343  AC C0GHU9.1
#=GS E6J9Y9_9ACTO/245-408  AC E6J9Y9.1
#=GS F7E2W6_MACMU/179-338  AC F7E2W6.1
#=GS Q09BK3_STIAD/232-391  AC Q09BK3.1
#=GS H1N072_9PLAN/184-346  AC H1N072.1
#=GS SAHH_COREF/236-398    AC Q8FRJ4.1
#=GS Q3TSQ0_MOUSE/1-57     AC Q3TSQ0.1
#=GS E2Q5D9_STRCL/270-432  AC E2Q5D9.1
#=GS H5TME4_9ACTO/249-410  AC H5TME4.1
#=GS E2V1Y7_MYCTU/253-415  AC E2V1Y7.1
#=GS Q31QL9_SYNE7/193-354  AC Q31QL9.1
#=GS Q68EX1_XENLA/347-508  AC Q68EX1.1
#=GS H5WZT9_9PSEU/243-405  AC H5WZT9.1
#=GS Q2KTA8_9GAMM/210-263  AC Q2KTA8.1
#=GS F7V8N1_CLOSS/183-344  AC F7V8N1.1
#=GS A3WCY2_9SPHN/233-392  AC A3WCY2.1
#=GS G4K2G3_9RHIZ/227-386  AC G4K2G3.1
#=GS H1KYK7_9EURY/188-348  AC H1KYK7.1
#=GS B9Z229_9NEIS/231-390  AC B9Z229.1
#=GS G5BPT7_HETGA/191-352  AC G5BPT7.1
#=GS F0G0Z2_9BURK/233-392  AC F0G0Z2.1
#=GS G4N4R7_MAGO7/194-355  AC G4N4R7.1
#=GS H2FQC6_CORPS/237-399  AC H2FQC6.1
#=GS B0RE61_CLAMS/252-414  AC B0RE61.1
#=GS C5NIH8_BURML/234-393  AC C5NIH8.1
#=GS F9ZJS1_9PROT/238-397  AC F9ZJS1.1
#=GS A8KEY6_BURPE/234-393  AC A8KEY6.1
#=GS C7D8T1_9RHOB/84-221   AC C7D8T1.1
#=GS F5KJM9_PSEAI/199-381  AC F5KJM9.1
#=GS G0S4M7_CHATD/194-355  AC G0S4M7.1
#=GS D4GZB1_HALVD/193-354  AC D4GZB1.1
#=GS E3I6Z6_RHOVT/225-384  AC E3I6Z6.1
#=GS SAHH_COXB1/199-358    AC B6J6H1.1
#=GS E1NP06_9LACO/182-330  AC E1NP06.1
#=GS H8EJ80_CLOTM/184-345  AC H8EJ80.1
#=GS B8J1W4_DESDA/233-395  AC B8J1W4.1
#=GS B4JHD2_DROGR/252-413  AC B4JHD2.1
#=GS C4GBW0_9FIRM/25-186   AC C4GBW0.1
#=GS G1PX61_MYOLU/268-429  AC G1PX61.1
#=GS D4AB27_RAT/182-337    AC D4AB27.1
#=GS SAHH_METCA/233-392    AC Q60CG8.1
#=GS G5BD70_HETGA/289-450  AC G5BD70.1
#=GS SAHH_ACIET/235-395    AC B9MD45.1
#=GS H1U1D3_9BACT/241-403  AC H1U1D3.1
#=GS D3SI12_DEHSG/185-346  AC D3SI12.1
#=GS F3JLF7_PSESX/199-381  AC F3JLF7.1
#=GS D7DKY0_METS0/235-394  AC D7DKY0.1
#=GS D7B5R0_NOCDD/236-398  AC D7B5R0.1
#=GS D1Y3T7_9BACT/184-345  AC D1Y3T7.1
#=GS H2I648_CORDP/236-398  AC H2I648.1
#=GS D2GWS9_AILME/213-374  AC D2GWS9.1
#=GS A3KZZ7_PSEAI/199-381  AC A3KZZ7.1
#=GS Q4JTP5_CORJK/233-399  AC Q4JTP5.1
#=GS A1U548_MARAV/200-376  AC A1U548.1
#=GS F2PBS5_PHOMO/205-347  AC F2PBS5.1
#=GS F8AEG7_PYRYC/189-350  AC F8AEG7.1
#=GS SAHH_METMA/181-341    AC Q8PUQ4.1
#=GS Q3S4E6_9AGAR/189-350  AC Q3S4E6.1
#=GS E4SAB4_CALKI/185-346  AC E4SAB4.1
#=GS Q6ZNS6_HUMAN/289-450  AC Q6ZNS6.1
#=GS E7KMM1_YEASL/194-355  AC E7KMM1.1
#=GS C7CMT1_METED/229-388  AC C7CMT1.1
#=GS C3MQ27_SULIL/209-370  AC C3MQ27.1
#=GS A1AK11_PELPD/226-385  AC A1AK11.1
#=GS A8MQP1_ARATH/240-311  AC A8MQP1.1
#=GS B3E065_METI4/189-351  AC B3E065.1
#=GS SAHH_CORGL/232-394    AC Q8NSC4.1
#=GS H6NPB7_9BACL/135-261  AC H6NPB7.1
#=GS D7CMR6_SYNLT/194-355  AC D7CMR6.1
#=GS G0EFR9_PYRF1/185-347  AC G0EFR9.1
#=GS A2BTK7_PROMS/238-397  AC A2BTK7.1
#=GS Q3ITF9_NATPD/191-352  AC Q3ITF9.1
#=GS E4ZLQ8_LEPMJ/194-355  AC E4ZLQ8.1
#=GS H8FMP5_RHOMO/227-386  AC H8FMP5.1
#=GS C7GSJ0_YEAS2/194-355  AC C7GSJ0.1
#=GS F2AVU6_RHOBT/196-366  AC F2AVU6.1
#=GS B8XIJ1_AMPCA/231-252  AC B8XIJ1.1
#=GS Q947H3_PETHY/196-349  AC Q947H3.1
#=GS SAHH3_HUMAN/370-531   AC Q96HN2.1
#=GS SAHH3_HUMAN/370-531   DR PDB; 3GVP D; 370-531;
#=GS SAHH3_HUMAN/370-531   DR PDB; 3GVP B; 370-531;
#=GS SAHH3_HUMAN/370-531   DR PDB; 3GVP C; 370-531;
#=GS SAHH3_HUMAN/370-531   DR PDB; 3GVP A; 370-531;
#=GS H8FEE1_XANCI/238-400  AC H8FEE1.1
#=GS F5HUG4_ACIBA/197-372  AC F5HUG4.1
#=GS A5YSW4_9EURY/197-358  AC A5YSW4.1
#=GS G2MMS4_9ARCH/192-353  AC G2MMS4.1
#=GS D5ZZ44_9ACTO/243-405  AC D5ZZ44.1
#=GS D0PMH9_BRUSS/227-386  AC D0PMH9.1
#=GS H7FPZ3_9FLAO/197-358  AC H7FPZ3.1
#=GS O29376_ARCFU/131-278  AC O29376.1
#=GS D8KL42_CORPF/237-399  AC D8KL42.1
#=GS SAHH_PSEAB/199-381    AC Q02TY0.1
#=GS F5L8Z0_9BACI/188-349  AC F5L8Z0.1
#=GS C6KVM9_9BACT/237-397  AC C6KVM9.1
#=GS E2REN0_CANFA/268-429  AC E2REN0.1
#=GS H9GL00_ANOCA/66-227   AC H9GL00.1
#=GS G1KIL2_ANOCA/44-205   AC G1KIL2.1
#=GS C9TNL7_9RHIZ/227-386  AC C9TNL7.1
#=GS G1LEV1_AILME/289-450  AC G1LEV1.1
#=GS SAHH_MYCSJ/248-409    AC A3PW97.1
#=GS SAHH_SYNY3/192-353    AC P74008.1
#=GS SAHH_BRUMB/227-386    AC C0RFY3.1
#=GS D1BWJ6_XYLCX/250-412  AC D1BWJ6.1
#=GS F0WFY9_9STRA/238-398  AC F0WFY9.1
#=GS F1YJG4_9ACTO/248-410  AC F1YJG4.1
#=GS I1EN94_AMPQE/53-212   AC I1EN94.1
#=GS G8AT59_AZOBR/200-359  AC G8AT59.1
#=GS B8CLF2_SHEPW/217-377  AC B8CLF2.1
#=GS H0QH73_ARTGO/240-407  AC H0QH73.1
#=GS G6GVS5_9CHRO/192-353  AC G6GVS5.1
#=GS C6H9E7_AJECH/665-826  AC C6H9E7.1
#=GS B9XT53_9BACT/245-407  AC B9XT53.1
#=GS SAHH_BRUSU/227-386    AC Q8FXZ7.1
#=GS H5S698_9NOCA/252-414  AC H5S698.1
#=GS F8I766_SULAT/187-349  AC F8I766.1
#=GS A8M3P7_SALAI/254-416  AC A8M3P7.1
#=GS D5VRX5_METIM/183-344  AC D5VRX5.1
#=GS F1WKY0_MORCA/208-381  AC F1WKY0.1
#=GS F8AK29_METOI/193-353  AC F8AK29.1
#=GS C0ZGB5_BREBN/188-349  AC C0ZGB5.1
#=GS G4LH77_PSEAI/195-377  AC G4LH77.1
#=GS A9AB24_METM6/183-343  AC A9AB24.1
#=GS D7AJV9_GEOSK/236-395  AC D7AJV9.1
#=GS B0R047_DANRE/274-435  AC B0R047.1
#=GS B0VUU5_ACIBS/197-372  AC B0VUU5.1
#=GS Q47LY4_THEFY/236-398  AC Q47LY4.1
#=GS E3CZ77_9BACT/185-346  AC E3CZ77.1
#=GS F9I7I2_ACIBA/197-372  AC F9I7I2.1
#=GS B8LLT6_PICSI/205-368  AC B8LLT6.1
#=GS D9XDZ7_STRVR/243-405  AC D9XDZ7.1
#=GS C9RCX3_AMMDK/184-345  AC C9RCX3.1
#=GS SAHH_BURM9/234-393    AC A2S6W2.1
#=GS H8XQC6_FLAIG/197-358  AC H8XQC6.1
#=GS Q84RD9_MEDTR/240-403  AC Q84RD9.1
#=GS F6B360_DESCC/185-346  AC F6B360.1
#=GS B4ULF9_ANASK/251-411  AC B4ULF9.1
#=GS D4H862_DENA2/228-390  AC D4H862.1
#=GS Q3R6Q1_XYLFA/238-400  AC Q3R6Q1.1
#=GS G5FW31_9PSED/199-381  AC G5FW31.1
#=GS B5DWE5_DROPS/252-413  AC B5DWE5.1
#=GS F2A732_RHIET/227-386  AC F2A732.1
#=GS F8FDP4_PAEMK/189-350  AC F8FDP4.1
#=GS F8M6G2_MYCA0/253-415  AC F8M6G2.1
#=GS SAHH_AERPE/186-347    AC Q9YEF2.2
#=GS F0XY15_AURAN/237-397  AC F0XY15.1
#=GS SAHH_ZYMMO/225-384    AC Q5NR48.1
#=GS H0UB90_BRELA/188-349  AC H0UB90.1
#=GS E1HE03_MYCTU/253-415  AC E1HE03.1
#=GS A4J677_DESRM/185-346  AC A4J677.1
#=GS D9SCR0_GALCS/231-390  AC D9SCR0.1
#=GS Q28IH7_XENTR/192-353  AC Q28IH7.1
#=GS Q24WB4_DESHY/192-353  AC Q24WB4.1
#=GS F6S1N6_CIOIN/253-414  AC F6S1N6.1
#=GS H6SNN4_RHOPH/306-465  AC H6SNN4.1
#=GS SAHH_STRAA/241-402    AC Q936D6.1
#=GS F7VUF3_SORMK/194-355  AC F7VUF3.1
#=GS Q2KTB2_9PSED/210-264  AC Q2KTB2.1
#=GS D1YRA9_9FIRM/184-345  AC D1YRA9.1
#=GS D8NA88_RALSL/231-390  AC D8NA88.1
#=GS G7GQI0_9ACTO/242-403  AC G7GQI0.1
#=GS D1CC75_THET1/183-344  AC D1CC75.1
#=GS B2A163_NATTJ/186-347  AC B2A163.1
#=GS A7I617_METB6/175-334  AC A7I617.1
#=GS Q1IKD7_KORVE/193-354  AC Q1IKD7.1
#=GS H0FB60_9BURK/232-391  AC H0FB60.1
#=GS Q28S16_JANSC/188-360  AC Q28S16.1
#=GS D6YW53_WADCW/197-360  AC D6YW53.1
#=GS C5C1M6_BEUC1/258-433  AC C5C1M6.1
#=GS G5AZL5_HETGA/152-313  AC G5AZL5.1
#=GS C7K603_ACEPA/189-348  AC C7K603.1
#=GS F5H737_HUMAN/163-324  AC F5H737.1
#=GS B4G2T2_DROPE/252-413  AC B4G2T2.1
#=GS F5UDB8_9CYAN/192-353  AC F5UDB8.1
#=GS G2NYW2_STRVO/167-325  AC G2NYW2.1
#=GS D4TLZ6_9NOST/192-353  AC D4TLZ6.1
#=GS SAHH_THEMA/174-335    AC O51933.2
#=GS E5AN60_BURRH/235-394  AC E5AN60.1
#=GS Q6NR07_DROME/280-441  AC Q6NR07.1
#=GS E6P8V4_9ARCH/202-363  AC E6P8V4.1
#=GS D5VBA2_MORCR/208-381  AC D5VBA2.1
#=GS G8X0C6_STREN/205-367  AC G8X0C6.1
#=GS E8X0E1_ACISM/243-404  AC E8X0E1.1
#=GS SAHH_ANOGA/191-352    AC O76757.2
#=GS E1V533_HALED/199-381  AC E1V533.1
#=GS G7P0M8_MACFA/311-472  AC G7P0M8.1
#=GS A5IDX2_LEGPC/145-267  AC A5IDX2.1
#=GS Q5BL43_XENTR/347-508  AC Q5BL43.1
#=GS Q1GCP9_SILST/223-381  AC Q1GCP9.1
#=GS D3TB74_ACIB4/171-331  AC D3TB74.1
#=GS SAHH_PROVI/231-393    AC A4SF77.1
#=GS F3E0E7_9PSED/199-381  AC F3E0E7.1
#=GS SAHH_COXBN/199-358    AC A9KD88.2
#=GS F3ZXN6_MAHA5/184-345  AC F3ZXN6.1
#=GS E5X8I5_9ACTN/187-348  AC E5X8I5.1
#=GS B8LL02_PICSI/240-403  AC B8LL02.1
#=GS Q6CYD7_KLULA/194-355  AC Q6CYD7.1
#=GS SAHH_MACFA/191-352    AC Q4R596.3
#=GS H2TK44_TAKRU/154-311  AC H2TK44.1
#=GS D6ZC50_SEGRD/3-50     AC D6ZC50.1
#=GS E3BYL9_9LACO/182-330  AC E3BYL9.1
#=GS H6Q7Q6_PYROT/205-367  AC H6Q7Q6.1
#=GS D2BEM5_STRRD/179-341  AC D2BEM5.1
#=GS B3QUB9_CHLT3/194-355  AC B3QUB9.1
#=GS Q1QAS6_PSYCK/210-386  AC Q1QAS6.1
#=GS D5PD23_9MYCO/251-413  AC D5PD23.1
#=GS D6KN03_9FIRM/184-345  AC D6KN03.1
#=GS SAHH_PSE14/199-381    AC Q48PB5.1
#=GS G1LF88_AILME/268-429  AC G1LF88.1
#=GS C4KHC1_SULIK/203-364  AC C4KHC1.1
#=GS C7JET9_ACEP3/189-348  AC C7JET9.1
#=GS SAHH_SYNPX/237-396    AC Q7U9Y3.1
#=GS F0LMS2_THEBM/188-349  AC F0LMS2.1
#=GS SAHH_SINMW/227-386    AC A6UEJ1.1
#=GS B9R054_9RHOB/177-335  AC B9R054.1
#=GS B8E158_DICTD/183-344  AC B8E158.1
#=GS D5YWK0_MYCTU/253-415  AC D5YWK0.1
#=GS D8JFN5_ACISD/197-372  AC D8JFN5.1
#=GS Q05UI7_9SYNE/237-396  AC Q05UI7.1
#=GS B9C036_9BURK/233-392  AC B9C036.1
#=GS E1ZSI5_CHLVA/239-401  AC E1ZSI5.1
#=GS G2L5G8_PSEAI/199-381  AC G2L5G8.1
#=GS G0FTF2_AMYMD/244-406  AC G0FTF2.1
#=GS D2QLN0_SPILD/195-356  AC D2QLN0.1
#=GS A5FXV7_ACICJ/195-354  AC A5FXV7.1
#=GS D7JX68_9BACE/236-398  AC D7JX68.1
#=GS SAHH_METAC/181-341    AC Q8TRA5.1
#=GS A4ID05_LEIIN/190-351  AC A4ID05.1
#=GS H2GN58_CORDP/236-398  AC H2GN58.1
#=GS C5K5D1_PERM5/232-396  AC C5K5D1.1
#=GS C7JLJ3_ACEPA/189-348  AC C7JLJ3.1
#=GS G9YGL0_9FIRM/184-345  AC G9YGL0.1
#=GS G1RG91_NOMLE/163-324  AC G1RG91.1
#=GS D3QAG7_STANL/242-404  AC D3QAG7.1
#=GS F1LR90_RAT/288-449    AC F1LR90.1
#=GS D3LLM4_MICLU/265-431  AC D3LLM4.1
#=GS SAHH_MEDSA/240-403    AC P50246.1
#=GS G6YWF9_9ALTE/200-376  AC G6YWF9.1
#=GS G3WY09_SARHA/191-352  AC G3WY09.1
#=GS A6LFM4_PARD8/232-394  AC A6LFM4.1
#=GS H3K498_9FIRM/184-345  AC H3K498.1
#=GS C6W310_DYAFD/197-358  AC C6W310.1
#=GS H2GWW1_CORDP/236-398  AC H2GWW1.1
#=GS F4GUC2_PUSST/235-394  AC F4GUC2.1
#=GS E6LST3_9LACO/183-331  AC E6LST3.1
#=GS D4KEZ0_9FIRM/184-345  AC D4KEZ0.1
#=GS E7QN29_9EURY/208-369  AC E7QN29.1
#=GS B1ZZ56_OPITP/233-394  AC B1ZZ56.1
#=GS C3NHE0_SULIN/209-370  AC C3NHE0.1
#=GS G6EI09_9SPHN/256-415  AC G6EI09.1
#=GS D3L235_9BACT/185-346  AC D3L235.1
#=GS Q0BJC6_BURCM/233-392  AC Q0BJC6.1
#=GS B9MQN9_ANATD/183-344  AC B9MQN9.1
#=GS D5EA53_METMS/181-341  AC D5EA53.1
#=GS G6FIL6_9EURY/175-334  AC G6FIL6.1
#=GS E3C223_9LACO/146-294  AC E3C223.1
#=GS F4DET3_AERVB/167-321  AC F4DET3.1
#=GS E3PQX6_9ASCI/1-104    AC E3PQX6.1
#=GS C3JG60_RHOER/250-412  AC C3JG60.1
#=GS Q47JN6_DECAR/227-386  AC Q47JN6.1
#=GS E7RA53_PICAD/190-351  AC E7RA53.1
#=GS I1C1Z9_RHIO9/192-353  AC I1C1Z9.1
#=GS SAHH_MYCPA/254-416    AC Q73UK6.1
#=GS SAHH_CUPTR/231-390    AC B2AGG2.1
#=GS SAHH_LEPIN/196-358    AC Q8EXV1.1
#=GS G8SCR0_ACTS5/244-406  AC G8SCR0.1
#=GS F7X2I0_SINMM/227-386  AC F7X2I0.1
#=GS F7PNV6_9EURY/190-351  AC F7PNV6.1
#=GS Q8GDW5_HELMO/194-355  AC Q8GDW5.1
#=GS Q1RMG2_HUMAN/65-226   AC Q1RMG2.1
#=GS B8J8T5_ANAD2/251-411  AC B8J8T5.1
#=GS B5ZE05_GLUDA/192-351  AC B5ZE05.1
#=GS Q5F3Q3_CHICK/285-446  AC Q5F3Q3.1
#=GS A9F0T5_9RHOB/228-387  AC A9F0T5.1
#=GS C3QAV2_9BACE/232-394  AC C3QAV2.2
#=GS H9F9W6_MACMU/216-377  AC H9F9W6.1
#=GS D1KCH0_9GAMM/197-373  AC D1KCH0.1
#=GS Q4YX83_PLABA/234-396  AC Q4YX83.1
#=GS B5IJJ2_9CHRO/236-395  AC B5IJJ2.1
#=GS B6R3K1_9RHOB/57-219   AC B6R3K1.1
#=GS D3CT52_9ACTO/236-398  AC D3CT52.1
#=GS SAHH_BRUA2/227-386    AC Q2YQX8.1
#=GS SAHH_BRUA2/227-386    DR PDB; 3N58 A; 227-386;
#=GS SAHH_BRUA2/227-386    DR PDB; 3N58 B; 227-386;
#=GS SAHH_BRUA2/227-386    DR PDB; 3N58 D; 227-386;
#=GS SAHH_BRUA2/227-386    DR PDB; 3N58 C; 227-386;
#=GS B0LJ03_9ACTO/227-389  AC B0LJ03.1
#=GS E6WQA4_PSEUU/240-401  AC E6WQA4.1
#=GS H2LNS4_ORYLA/261-422  AC H2LNS4.1
#=GS G7XRJ7_ASPKW/194-355  AC G7XRJ7.1
#=GS F7P8Q1_MYCPA/254-416  AC F7P8Q1.1
#=GS A9K139_BURML/234-393  AC A9K139.1
#=GS F9U824_9GAMM/229-388  AC F9U824.1
#=GS C6IJV9_9BACE/232-394  AC C6IJV9.2
#=GS I0GY61_ACTMI/244-406  AC I0GY61.1
#=GS D3SNT1_THEAH/185-346  AC D3SNT1.1
#=GS H3QUX0_BRUAO/227-386  AC H3QUX0.1
#=GS G8JQF8_ERECY/194-355  AC G8JQF8.1
#=GS E3D8S0_GARV3/263-419  AC E3D8S0.1
#=GS Q1VW91_9FLAO/195-356  AC Q1VW91.1
#=GS F7ZGB9_ROSLO/223-382  AC F7ZGB9.1
#=GS D9UXD9_9ACTO/248-410  AC D9UXD9.1
#=GS F1YT93_9PROT/189-348  AC F1YT93.1
#=GS D3HKF7_LEGLN/202-361  AC D3HKF7.1
#=GS F7QQM2_9BRAD/237-396  AC F7QQM2.1
#=GS SAHH_YEAST/194-355    AC P39954.1
#=GS E8JJ13_9ACTO/214-375  AC E8JJ13.1
#=GS A3SUG1_9RHOB/223-382  AC A3SUG1.1
#=GS G2EHC6_9FLAO/197-358  AC G2EHC6.1
#=GS SAHH_METJA/183-343    AC Q58783.1
#=GS B4QNL7_DROSI/280-441  AC B4QNL7.1
#=GS B2V774_SULSY/185-346  AC B2V774.1
#=GS SAHH_MYCSK/248-409    AC A1UCK8.1
#=GS H0GF30_9SACH/194-355  AC H0GF30.1
#=GS F4G642_ALIDK/235-395  AC F4G642.1
#=GS Q29G51_DROPS/191-352  AC Q29G51.1
#=GS I1KS65_SOYBN/240-403  AC I1KS65.1
#=GS G4QTP7_CORPS/237-399  AC G4QTP7.1
#=GS F6RMS6_CALJA/267-428  AC F6RMS6.1
#=GS Q84G37_RHIRD/190-349  AC Q84G37.1
#=GS D0BE57_BRUSS/227-386  AC D0BE57.1
#=GS A9G6Z6_9RHOB/224-383  AC A9G6Z6.1
#=GS F1WTX2_MORCA/208-381  AC F1WTX2.1
#=GS E0UCR8_CYAP2/196-357  AC E0UCR8.1
#=GS SAHH_METEP/229-388    AC A9VYP7.1
#=GS D3XE01_BRUML/242-401  AC D3XE01.1
#=GS G2EQ70_CORGT/236-398  AC G2EQ70.1
#=GS F0HSR3_9ACTN/187-348  AC F0HSR3.1
#=GS A9DL51_9FLAO/197-358  AC A9DL51.1
#=GS H5YHT4_9BRAD/232-391  AC H5YHT4.1
#=GS A6FL17_9RHOB/223-382  AC A6FL17.1
#=GS C6AB55_BARGA/226-385  AC C6AB55.1
#=GS B9NUA0_9RHOB/227-386  AC B9NUA0.1
#=GS Q4FP70_PELUB/189-348  AC Q4FP70.1
#=GS F7E2Y1_MACMU/187-345  AC F7E2Y1.1
#=GS F8H442_PSEUT/199-380  AC F8H442.1
#=GS A9RPK9_PHYPA/240-403  AC A9RPK9.1
#=GS C6A279_THESM/188-349  AC C6A279.1
#=GS E3KAS1_PUCGT/189-350  AC E3KAS1.1
#=GS Q3SQ10_NITWN/244-403  AC Q3SQ10.1
#=GS B4GVX7_DROPE/191-352  AC B4GVX7.1
#=GS I0BQ70_9BACL/189-350  AC I0BQ70.1
#=GS F8ENW7_RUNSL/197-358  AC F8ENW7.1
#=GS E6YFT1_BARC7/220-379  AC E6YFT1.1
#=GS Q0ISV7_ORYSJ/270-433  AC Q0ISV7.2
#=GS SAHH_THEVO/177-338    AC Q979Z4.1
#=GS Q6J699_9BURK/241-400  AC Q6J699.1
#=GS Q28JX1_JANSC/222-381  AC Q28JX1.1
#=GS B8C553_THAPS/238-398  AC B8C553.1
#=GS H1UDH8_ACEPA/189-348  AC H1UDH8.1
#=GS C4WWQ3_ACYPI/25-186   AC C4WWQ3.1
#=GS I0AGL0_9BACT/201-362  AC I0AGL0.1
#=GS C7JVR1_ACEPA/189-348  AC C7JVR1.1
#=GS SAHH_RHIEC/227-386    AC Q2KE72.1
#=GS Q1YUX1_9GAMM/195-368  AC Q1YUX1.1
#=GS H3Q4B5_BRUAO/227-386  AC H3Q4B5.1
#=GS F5Z1Y8_MYCSD/243-405  AC F5Z1Y8.1
#=GS F3IG08_PSESL/199-381  AC F3IG08.1
#=GS C9YZJ1_STRSW/243-405  AC C9YZJ1.1
#=GS G4RL08_THETK/204-366  AC G4RL08.1
#=GS E9IBV6_SOLIN/184-344  AC E9IBV6.1
#=GS F4NWV0_BATDJ/192-353  AC F4NWV0.1
#=GS C8PCN7_9LACO/182-330  AC C8PCN7.1
#=GS B0RV76_XANCB/298-460  AC B0RV76.1
#=GS B1VF99_CORU7/249-415  AC B1VF99.1
#=GS E4SRH0_STRTN/347-494  AC E4SRH0.1
#=GS H8Z8X7_NEMS1/193-354  AC H8Z8X7.1
#=GS E3IX02_FRASU/173-334  AC E3IX02.1
#=GS G0H048_METMI/183-343  AC G0H048.1
#=GS E4SFU5_CALK2/185-346  AC E4SFU5.1
#=GS H2JTP9_STRHJ/175-339  AC H2JTP9.1
#=GS B8LKF8_PICSI/240-403  AC B8LKF8.1
#=GS H1ETX9_9ARCH/188-349  AC H1ETX9.1
#=GS H1VPW1_COLHI/194-355  AC H1VPW1.1
#=GS Q011K7_OSTTA/177-339  AC Q011K7.1
#=GS B4ZG42_AMPCA/84-246   AC B4ZG42.1
#=GS F0UB38_AJEC8/667-828  AC F0UB38.1
#=GS E2TG65_MYCTU/253-415  AC E2TG65.1
#=GS I0KJL0_STEMA/239-401  AC I0KJL0.1
#=GS Q0A6D2_ALHEH/231-390  AC Q0A6D2.1
#=GS D3PJ79_9MAXI/191-352  AC D3PJ79.1
#=GS SAHH_RALSO/231-390    AC Q8Y387.1
#=GS E0DTT4_9RHIZ/227-386  AC E0DTT4.1
#=GS D9U9X0_MACLA/7-24     AC D9U9X0.1
#=GS H2TK43_TAKRU/276-437  AC H2TK43.1
#=GS D3RMM5_ALLVD/229-388  AC D3RMM5.1
#=GS G8LUB4_CLOCD/184-345  AC G8LUB4.1
#=GS A3VCW9_9RHOB/225-384  AC A3VCW9.1
#=GS G0JN36_9GAMM/196-380  AC G0JN36.1
#=GS D9U9X2_ISOOB/7-24     AC D9U9X2.1
#=GS I0Y2C2_9BURK/234-393  AC I0Y2C2.1
#=GS D3F927_CONWI/189-350  AC D3F927.1
#=GS F6BB67_METIK/195-355  AC F6BB67.1
#=GS C1F1E9_ACIC5/192-353  AC C1F1E9.1
#=GS Q5CBC1_9THEM/169-330  AC Q5CBC1.1
#=GS D3S7Z6_METSF/183-343  AC D3S7Z6.1
#=GS F0S060_DESTD/186-347  AC F0S060.1
#=GS SAHH_STRFR/2-40       AC P26799.1
#=GS F2GU87_BRUM5/231-390  AC F2GU87.1
#=GS G2PAJ8_STRVO/243-405  AC G2PAJ8.1
#=GS SAHH_FLAPJ/197-358    AC A6GW32.1
#=GS A9N9E1_COXBR/195-354  AC A9N9E1.1
#=GS A5THI7_BURML/234-393  AC A5THI7.1
#=GS Q1H4X3_METFK/231-390  AC Q1H4X3.1
#=GS H2Z7I8_CIOSA/320-481  AC H2Z7I8.1
#=GS D9ZCI7_9CARY/1-123    AC D9ZCI7.1
#=GS Q0F166_9PROT/199-341  AC Q0F166.1
#=GS C6BI01_RALP1/231-390  AC C6BI01.1
#=GS E2XZM0_PSEFL/199-381  AC E2XZM0.1
#=GS Q4UCR8_THEAN/245-409  AC Q4UCR8.1
#=GS I1BJC4_RHIO9/25-186   AC I1BJC4.1
#=GS E2A9N0_CAMFO/313-474  AC E2A9N0.1
#=GS F2GKC4_MYCTU/253-415  AC F2GKC4.1
#=GS SAHH_CANAL/195-356    AC P83783.2
#=GS D2C7G0_THENR/174-335  AC D2C7G0.1
#=GS SAHH_GRAFK/197-358    AC A0M5W6.1
#=GS F7GIM7_MACMU/153-312  AC F7GIM7.1
#=GS F9CX98_9ARCH/184-345  AC F9CX98.1
#=GS C9KRC9_9BACE/236-398  AC C9KRC9.1
#=GS G1TH73_RABIT/171-312  AC G1TH73.1
#=GS D1F0P1_BRUML/227-386  AC D1F0P1.1
#=GS SAHH_SULAC/182-343    AC Q4JAZ7.1
#=GS Q1QJR6_NITHX/237-396  AC Q1QJR6.1
#=GS F7V0L7_EEGSY/185-346  AC F7V0L7.1
#=GS H1IHD0_9FIRM/184-345  AC H1IHD0.1
#=GS E7LTS5_YEASV/194-355  AC E7LTS5.1
#=GS Q5ZTY7_LEGPH/202-361  AC Q5ZTY7.1
#=GS D4IQ52_9BACT/230-391  AC D4IQ52.1
#=GS D0AYN4_BRUAO/227-386  AC D0AYN4.1
#=GS B8FFD8_DESAA/229-391  AC B8FFD8.1
#=GS C7QCG3_CATAD/243-405  AC C7QCG3.1
#=GS SAHH_SYNSC/237-396    AC Q3ANF4.1
#=GS A1KYB2_TOBAC/240-403  AC A1KYB2.1
#=GS SAHH_FLAJ1/197-358    AC A5FJK3.1
#=GS A3U6H9_CROAH/197-358  AC A3U6H9.1
#=GS SAHH_DESAD/232-394    AC C6C1F4.1
#=GS H2TA80_TAKRU/265-426  AC H2TA80.1
#=GS G3RMJ5_GORGO/287-448  AC G3RMJ5.1
#=GS H8EY91_MYCTE/253-415  AC H8EY91.1
#=GS A8GBG5_SERP5/175-324  AC A8GBG5.1
#=GS H2Z7J1_CIOSA/172-333  AC H2Z7J1.1
#=GS F7U3G2_RHIRD/227-386  AC F7U3G2.1
#=GS D8I300_AMYMU/244-406  AC D8I300.1
#=GS F4L580_HALH1/195-356  AC F4L580.1
#=GS Q2VYY0_MAGSA/224-383  AC Q2VYY0.1
#=GS A3UKP0_9RHOB/233-392  AC A3UKP0.1
#=GS B1L7G9_KORCO/181-342  AC B1L7G9.1
#=GS F2NJ78_DESAR/200-361  AC F2NJ78.1
#=GS SAHH_OCHA4/227-386    AC A6WX40.1
#=GS B6EBE6_NICBE/2-138    AC B6EBE6.1
#=GS A4JAE5_BURVG/233-392  AC A4JAE5.1
#=GS G0A5S3_METMM/191-350  AC G0A5S3.1
#=GS Q7YUF0_TRYCR/190-351  AC Q7YUF0.1
#=GS E4XGP7_OIKDI/257-418  AC E4XGP7.1
#=GS D8FF04_9DELT/208-369  AC D8FF04.1
#=GS SAHH_BORPD/232-391    AC A9IGY5.1
#=GS B3NTL4_DROER/191-352  AC B3NTL4.1
#=GS A6RR00_BOTFB/194-355  AC A6RR00.1
#=GS G3T5Z2_LOXAF/289-450  AC G3T5Z2.1
#=GS A4SPE0_AERS4/206-360  AC A4SPE0.1
#=GS G2HH23_PANTR/211-372  AC G2HH23.1
#=GS D6CV63_THIS3/233-392  AC D6CV63.1
#=GS F7H6W6_MACMU/267-428  AC F7H6W6.1
#=GS F0T0X0_SYNGF/186-347  AC F0T0X0.1
#=GS I0K0F4_9BACT/189-351  AC I0K0F4.1
#=GS E2MV36_9CORY/238-404  AC E2MV36.1
#=GS Q5DH82_SCHJA/284-442  AC Q5DH82.1
#=GS Q1MYH6_9GAMM/195-371  AC Q1MYH6.1
#=GS H6S7Q1_MYCTU/253-415  AC H6S7Q1.1
#=GS H2HAU9_CORDP/236-398  AC H2HAU9.1
#=GS B3DT49_BIFLD/261-420  AC B3DT49.1
#=GS G2TDH3_RHORU/226-385  AC G2TDH3.1
#=GS Q5DCT4_SCHJA/191-352  AC Q5DCT4.1
#=GS E2ZCI8_9FIRM/184-345  AC E2ZCI8.1
#=GS D8VMA0_9NEOP/53-213   AC D8VMA0.1
#=GS E3IQY6_DESVR/238-400  AC E3IQY6.1
#=GS H2TA77_TAKRU/309-470  AC H2TA77.1
#=GS A1VJI2_POLNA/238-397  AC A1VJI2.1
#=GS F4MLZ7_9BACT/197-358  AC F4MLZ7.1
#=GS A8SP22_9FIRM/142-276  AC A8SP22.1
#=GS A0B7W5_METTP/185-346  AC A0B7W5.1
#=GS F7HC31_CALJA/242-403  AC F7HC31.1
#=GS C9M537_9BACT/184-345  AC C9M537.1
#=GS Q0W1B4_UNCMA/186-347  AC Q0W1B4.1
#=GS D2REF1_ARCPA/178-338  AC D2REF1.1
#=GS F4LAX9_BORPC/232-391  AC F4LAX9.1
#=GS H8L337_FRAAD/235-397  AC H8L337.1
#=GS D8G9I8_9CYAN/192-353  AC D8G9I8.1
#=GS C9UV04_BRUAO/227-386  AC C9UV04.1
#=GS SAHH_XYLFT/238-400    AC Q87EI8.1
#=GS C7QZI2_JONDD/250-412  AC C7QZI2.1
#=GS Q2NKW8_HUMAN/264-425  AC Q2NKW8.1
#=GS B8KLD0_9GAMM/199-375  AC B8KLD0.1
#=GS E8V5Z9_TERSS/234-396  AC E8V5Z9.1
#=GS A3S9K4_9RHOB/223-382  AC A3S9K4.1
#=GS A8V0A1_9AQUI/274-435  AC A8V0A1.1
#=GS H3SCB6_9BACL/191-352  AC H3SCB6.1
#=GS H0E841_9ACTN/242-404  AC H0E841.1
#=GS A9NUB8_PICSI/240-403  AC A9NUB8.1
#=GS Q3U4D1_MOUSE/191-352  AC Q3U4D1.1
#=GS B2UR10_AKKM8/229-391  AC B2UR10.1
#=GS H2KVS1_CLOSI/164-230  AC H2KVS1.1
#=GS Q4RVT5_TETNG/252-407  AC Q4RVT5.1
#=GS G2XCD2_VERDV/194-355  AC G2XCD2.1
#=GS H3T5L2_PSEAE/199-381  AC H3T5L2.1
#=GS B8HEZ4_ARTCA/240-406  AC B8HEZ4.1
#=GS F7F2V3_MONDO/369-530  AC F7F2V3.1
#=GS F8JVA4_STREN/243-405  AC F8JVA4.1
#=GS E6VY68_DESAO/236-398  AC E6VY68.1
#=GS F0TBU2_METSL/184-345  AC F0TBU2.1
#=GS C7TYU5_SCHJA/284-445  AC C7TYU5.1
#=GS G8W8N2_KLEOK/177-326  AC G8W8N2.1
#=GS G7E824_MIXOS/200-361  AC G7E824.1
#=GS H0T0Y8_9BRAD/229-388  AC H0T0Y8.1
#=GS D7UEQ7_HUMAN/268-429  AC D7UEQ7.1
#=GS F4XDT2_9FIRM/183-344  AC F4XDT2.1
#=GS G3MRB8_9ACAR/164-325  AC G3MRB8.1
#=GS D4AW94_ARTBC/165-326  AC D4AW94.1
#=GS A2QQB9_ASPNC/194-355  AC A2QQB9.1
#=GS F8BLD0_OLICM/231-390  AC F8BLD0.1
#=GS F1S4Y7_PIG/182-343    AC F1S4Y7.1
#=GS C4RRA0_9ACTO/257-419  AC C4RRA0.1
#=GS F8NGF9_SERL9/189-350  AC F8NGF9.1
#=GS F5XQ99_MICPN/241-407  AC F5XQ99.1
#=GS D2UFV6_XANAP/239-401  AC D2UFV6.1
#=GS G9EIU2_9GAMM/198-357  AC G9EIU2.1
#=GS I1ABW6_PSEAI/199-381  AC I1ABW6.1
#=GS D9U9W5_DROAU/7-24     AC D9U9W5.1
#=GS H3G8U2_PHYRM/238-398  AC H3G8U2.1
#=GS Q1NDX6_9SPHN/57-216   AC Q1NDX6.1
#=GS E7PBR8_PSESG/199-381  AC E7PBR8.1
#=GS SAHH_METC4/229-388    AC B7KSJ4.1
#=GS Q4TI33_TETNG/1-44     AC Q4TI33.1
#=GS D9U9X1_PERGU/7-24     AC D9U9X1.1
#=GS C4B1X4_BURML/234-393  AC C4B1X4.1
#=GS SAHH_AROAE/231-390    AC Q5P6B7.1
#=GS H1J6E0_9FIRM/189-350  AC H1J6E0.1
#=GS H3C716_TETNG/69-228   AC H3C716.1
#=GS Q2U2K8_ASPOR/194-355  AC Q2U2K8.1
#=GS Q111K6_TRIEI/192-353  AC Q111K6.1
#=GS A9NWW8_PICSI/240-403  AC A9NWW8.1
#=GS B0T1Y2_CAUSK/224-383  AC B0T1Y2.1
#=GS F7I7C4_CALJA/242-403  AC F7I7C4.1
#=GS E7QDV1_YEASZ/194-355  AC E7QDV1.1
#=GS B5I8X6_9ACTO/243-405  AC B5I8X6.1
#=GS E8YHX4_9BURK/234-393  AC E8YHX4.1
#=GS F0DLP7_9FIRM/185-346  AC F0DLP7.1
#=GS E8T304_THEA1/186-347  AC E8T304.1
#=GS G4M0M6_SCHMA/279-440  AC G4M0M6.1
#=GS E1QQJ4_VULDI/204-366  AC E1QQJ4.1
#=GS Q6C211_YARLI/194-355  AC Q6C211.1
#=GS B5IZT7_9RHOB/223-382  AC B5IZT7.1
#=GS D7L441_ARALL/240-403  AC D7L441.1
#=GS B4W6B7_9CAUL/224-383  AC B4W6B7.1
#=GS A5PKK6_BOVIN/382-543  AC A5PKK6.1
#=GS A7AW30_BABBO/245-409  AC A7AW30.1
#=GS A3I390_9BACT/198-359  AC A3I390.1
#=GS A6UNQ1_METVS/183-343  AC A6UNQ1.1
#=GS B4KBL6_DROMO/249-410  AC B4KBL6.1
#=GS D7WAA4_9CORY/240-402  AC D7WAA4.1
#=GS O43210_HUMAN/2-138    AC O43210.1
#=GS SAHH_CATRO/240-403    AC P35007.1
#=GS Q84RD8_MEDTR/240-403  AC Q84RD8.1
#=GS G3BD47_CANTC/194-355  AC G3BD47.1
#=GS B3PGF1_CELJU/198-374  AC B3PGF1.1
#=GS SAHH_RAT/191-352      AC P10760.3
#=GS SAHH_RAT/191-352      DR PDB; 1K0U F; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1K0U E; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1K0U H; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1B3R A; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1XWF D; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY4 A; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1B3R B; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1K0U C; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1K0U A; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1XWF B; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY4 D; 3190-3351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY4 C; 2190-2351;
#=GS SAHH_RAT/191-352      DR PDB; 1K0U B; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1XWF C; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1K0U G; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1K0U D; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L D; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L E; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L F; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L H; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY5 D; 3190-3351;
#=GS SAHH_RAT/191-352      DR PDB; 1D4F B; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L B; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1B3R C; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY4 B; 1190-1351;
#=GS SAHH_RAT/191-352      DR PDB; 1D4F C; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L C; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY5 B; 1190-1351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY5 A; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1D4F D; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1B3R D; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1XWF A; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1D4F A; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 1KY5 C; 2190-2351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L A; 190-351;
#=GS SAHH_RAT/191-352      DR PDB; 2H5L G; 190-351;
#=GS F6PGQ3_CALJA/163-324  AC F6PGQ3.1
#=GS B5JLM7_9BACT/232-394  AC B5JLM7.1
#=GS D5T5Z8_LEGP2/202-361  AC D5T5Z8.1
#=GS D5W6A0_BURSC/233-392  AC D5W6A0.1
#=GS F7I9M9_CALJA/264-425  AC F7I9M9.1
#=GS Q6T2C8_PICPA/190-351  AC Q6T2C8.1
#=GS F5KYN9_9FIRM/184-345  AC F5KYN9.1
#=GS F5IFU6_ACIBA/197-372  AC F5IFU6.1
#=GS E5G3R3_9CHLO/243-405  AC E5G3R3.1
#=GS F7A3U6_ORNAN/267-428  AC F7A3U6.1
#=GS SAHH_LUPLU/240-403    AC Q9SP37.1
#=GS SAHH_LUPLU/240-403    DR PDB; 3ONF A; 240-403;
#=GS SAHH_LUPLU/240-403    DR PDB; 3ONE B; 240-403;
#=GS SAHH_LUPLU/240-403    DR PDB; 3ONE A; 240-403;
#=GS SAHH_LUPLU/240-403    DR PDB; 3OND B; 240-403;
#=GS SAHH_LUPLU/240-403    DR PDB; 3OND A; 240-403;
#=GS SAHH_LUPLU/240-403    DR PDB; 3ONF B; 240-403;
#=GS D5MJ17_9BACT/240-402  AC D5MJ17.1
#=GS H1P1B2_9BACT/228-387  AC H1P1B2.1
#=GS A7HJC0_FERNB/173-333  AC A7HJC0.1
#=GS F6Z693_MONDO/192-353  AC F6Z693.1
#=GS SAHH2_HUMAN/289-450   AC O43865.2
#=GS SAHH2_HUMAN/289-450   DR PDB; 3MTG B; 289-450;
#=GS SAHH2_HUMAN/289-450   DR PDB; 3MTG A; 289-450;
#=GS A6ZQZ2_YEAS7/194-355  AC A6ZQZ2.1
#=GS F3IY24_PSEAP/199-381  AC F3IY24.1
#=GS Q0V8U4_TAKRU/295-456  AC Q0V8U4.1
#=GS Q2FPV2_METHJ/175-334  AC Q2FPV2.1
#=GS Q20YV8_RHOPB/240-399  AC Q20YV8.1
#=GS F9WIR3_TRYCI/190-268  AC F9WIR3.1
#=GS E2MM29_PSEUB/199-381  AC E2MM29.1
#=GS SAHH_LEIDO/190-351    AC P36889.2
#=GS Q5M5Z7_STRT2/347-494  AC Q5M5Z7.1
#=GS E5LG77_CUCSA/240-403  AC E5LG77.1
#=GS C9TDH5_9RHIZ/227-386  AC C9TDH5.1
#=GS G2JD14_ACIBA/197-372  AC G2JD14.1
#=GS H3R5W4_BRUAO/227-386  AC H3R5W4.1
#=GS B4R576_DROSI/191-352  AC B4R576.1
#=GS F7DC90_MACMU/191-352  AC F7DC90.1
#=GS D0KTF7_SULS9/203-364  AC D0KTF7.1
#=GS B3M2C3_DROAN/252-413  AC B3M2C3.1
#=GS C0QUI0_PERMH/185-346  AC C0QUI0.1
#=GS C4V2H6_9FIRM/187-348  AC C4V2H6.1
#=GS G7V9Q3_THELD/181-342  AC G7V9Q3.1
#=GS G2DFN8_9GAMM/189-350  AC G2DFN8.1
#=GS Q8KYV9_9PROT/224-383  AC Q8KYV9.1
#=GS I0IB66_9BACT/269-429  AC I0IB66.1
#=GS G3UTV5_MELGA/251-412  AC G3UTV5.1
#=GS SAHH_PYRAB/189-350    AC Q9UYK5.1
#=GS F2TBY0_AJEDA/194-355  AC F2TBY0.1
#=GS B5VZG4_SPIMA/192-353  AC B5VZG4.1
#=GS SAHH_PROMA/237-396    AC Q7V9P3.1
#=GS H2XF57_CAEJA/228-387  AC H2XF57.1
#=GS G6Y776_9RHIZ/227-386  AC G6Y776.1
#=GS A1K2Z9_AZOSB/230-389  AC A1K2Z9.1
#=GS G0BEE2_SERSA/175-324  AC G0BEE2.1
#=GS G3YRK2_9RALS/231-390  AC G3YRK2.1
#=GS C6XU72_PEDHD/197-358  AC C6XU72.1
#=GS SAHH_CAUCR/224-383    AC Q9ABH0.1
#=GS SAHH_BURMS/234-393    AC A1V8Z2.1
#=GS G2FRP2_9FIRM/184-345  AC G2FRP2.1
#=GS G0RRE6_HYPJQ/194-355  AC G0RRE6.1
#=GS C6IAY7_9BACE/232-394  AC C6IAY7.2
#=GS Q3M618_ANAVT/192-353  AC Q3M618.1
#=GS SAHH_XANC8/238-400    AC Q4UQZ8.1
#=GS SAHH_BRASB/232-391    AC A5ENA7.1
#=GS F5M2J5_RHOSH/224-383  AC F5M2J5.1
#=GS D1B5H6_THEAS/182-343  AC D1B5H6.1
#=GS F0SLX0_PLABD/194-362  AC F0SLX0.1
#=GS F4FBQ5_VERMA/248-410  AC F4FBQ5.1
#=GS G4IZJ4_9PSEU/243-405  AC G4IZJ4.1
#=GS D9U9W6_NOTTY/7-24     AC D9U9W6.1
#=GS A8UIU8_9FLAO/197-358  AC A8UIU8.1
#=GS F1XAP2_MORCA/208-381  AC F1XAP2.1
#=GS D9ZCI6_9CARY/1-123    AC D9ZCI6.1
#=GS C2GUL4_BIFLN/261-420  AC C2GUL4.1
#=GS A1WFN2_VEREI/233-392  AC A1WFN2.1
#=GS A8ZT03_DESOH/190-350  AC A8ZT03.1
#=GS G1NSZ4_MYOLU/250-410  AC G1NSZ4.1
#=GS I0AR34_CORPS/237-399  AC I0AR34.1
#=GS H8G799_9PSEU/243-405  AC H8G799.1
#=GS E4MEC7_9BACT/230-391  AC E4MEC7.1
#=GS H2L3V5_ORYLA/310-471  AC H2L3V5.1
#=GS F6XTJ0_MACMU/190-349  AC F6XTJ0.1
#=GS H0PRP7_9RHOO/235-394  AC H0PRP7.1
#=GS H9Z4K5_MACMU/289-450  AC H9Z4K5.1
#=GS A8F5L1_THELT/174-335  AC A8F5L1.1
#=GS C9UFS4_BRUAO/227-386  AC C9UFS4.1
#=GS C6U0P4_BURPE/234-393  AC C6U0P4.1
#=GS F7QCM2_9GAMM/232-393  AC F7QCM2.1
#=GS D9ZCJ8_9CARY/1-123    AC D9ZCJ8.1
#=GS H6C6Z9_EXODN/195-356  AC H6C6Z9.1
#=GS F0P0I4_WEEVC/216-377  AC F0P0I4.1
#=GS Q5DUG9_CICAR/240-403  AC Q5DUG9.1
#=GS C7LEX2_BRUMC/227-386  AC C7LEX2.1
#=GS I0IQ74_9BACT/185-346  AC I0IQ74.1
#=GS B0CN34_STRLA/242-404  AC B0CN34.1
#=GS H9JNR4_BOMMO/154-314  AC H9JNR4.1
#=GS A8YEP8_MICAE/192-353  AC A8YEP8.1
#=GS G0W786_NAUDC/194-355  AC G0W786.1
#=GS E9T3B7_COREQ/250-412  AC E9T3B7.1
#=GS B3VIE4_POPTN/1-115    AC B3VIE4.1
#=GS H2C6P0_9CREN/183-344  AC H2C6P0.1
#=GS H2YAU8_CIOSA/182-367  AC H2YAU8.1
#=GS C3XBX4_OXAFO/231-390  AC C3XBX4.1
#=GS G8YUG2_PICSO/194-355  AC G8YUG2.1
#=GS Q9R6R6_MYCBO/61-181   AC Q9R6R6.1
#=GS C0XVZ2_BURPE/234-393  AC C0XVZ2.1
#=GS A7SRK8_NEMVE/238-399  AC A7SRK8.1
#=GS B3V593_9ARCH/183-344  AC B3V593.1
#=GS C6D568_PAESJ/188-349  AC C6D568.1
#=GS F9T4E0_9VIBR/187-349  AC F9T4E0.1
#=GS E1NFC0_9LACO/182-330  AC E1NFC0.1
#=GS B4U7V0_HYDS0/185-349  AC B4U7V0.1
#=GS G7HMC7_9BURK/233-392  AC G7HMC7.1
#=GS C0QES7_DESAH/239-401  AC C0QES7.1
#=GS B7P4Y1_IXOSC/184-345  AC B7P4Y1.1
#=GS G8RK22_MYCRN/244-406  AC G8RK22.1
#=GS SAHH_HALHL/191-350    AC A1WXM7.1
#=GS E9ZP12_MYCTU/253-415  AC E9ZP12.1
#=GS H9IES6_ATTCE/243-404  AC H9IES6.1
#=GS H3MPK8_KLEOX/177-326  AC H3MPK8.1
#=GS SAHH_THEAC/177-338    AC Q9HKX4.1
#=GS F7C5P7_HORSE/284-445  AC F7C5P7.1
#=GS D6TBQ6_9CHLR/182-343  AC D6TBQ6.1
#=GS SAHH_METTH/184-345    AC O27673.1
#=GS C9RID4_METVM/183-343  AC C9RID4.1
#=GS G7W2T3_PAETH/135-261  AC G7W2T3.1
#=GS Q88AD7_PSESM/169-256  AC Q88AD7.1
#=GS B4L1T2_DROMO/191-352  AC B4L1T2.1
#=GS Q124L7_POLSJ/239-398  AC Q124L7.1
#=GS C7P826_METFA/183-343  AC C7P826.1
#=GS H2M521_ORYLA/265-426  AC H2M521.1
#=GS E5Y0G5_9BIFI/261-420  AC E5Y0G5.1
#=GS H2BRY7_9FLAO/197-358  AC H2BRY7.1
#=GS SAHH_STRAW/243-405    AC Q82DC9.1
#=GS F4JTV5_ARATH/119-282  AC F4JTV5.1
#=GS G8QGH3_AZOSU/227-386  AC G8QGH3.1
#=GS SAHH_SYNPW/237-396    AC A5GI30.1
#=GS G9XPJ5_DESHA/196-357  AC G9XPJ5.1
#=GS D4D395_TRIVH/165-326  AC D4D395.1
#=GS H8INX7_MYCIA/248-410  AC H8INX7.1
#=GS A2C573_PROM1/238-397  AC A2C573.1
#=GS H0URH4_9BACT/183-344  AC H0URH4.1
#=GS F0M5M5_ARTPP/240-406  AC F0M5M5.1
#=GS G0UCH5_TRYVI/190-351  AC G0UCH5.1
#=GS H1YHB7_9SPHI/197-358  AC H1YHB7.1
#=GS D6EMU7_STRLI/172-330  AC D6EMU7.1
#=GS D3TM10_GLOMM/191-352  AC D3TM10.1
#=GS D9PUD2_METTM/184-345  AC D9PUD2.1
#=GS D8NRH9_RALSL/231-390  AC D8NRH9.1
#=GS G7QPR1_LEPII/196-358  AC G7QPR1.1
#=GS Q4LB20_HORVU/205-368  AC Q4LB20.1
#=GS E1L6Z4_9FIRM/184-345  AC E1L6Z4.1
#=GS C0A8S2_9BACT/225-387  AC C0A8S2.1
#=GS A9WU61_RENSM/240-406  AC A9WU61.1
#=GS G1WZT6_ARTOA/194-355  AC G1WZT6.1
#=GS I0FJW0_MACMU/191-352  AC I0FJW0.1
#=GS SAHH_RHIL3/227-386    AC Q1MNC6.1
#=GS E2WA12_MYCTU/253-415  AC E2WA12.1
#=GS D1JGX6_9ARCH/185-346  AC D1JGX6.1
#=GS D1BC91_SANKS/257-423  AC D1BC91.1
#=GS SAHH_NOVAD/229-388    AC Q2G6T1.1
#=GS D4A5X8_RAT/242-403    AC D4A5X8.1
#=GS G9YR99_9FIRM/183-344  AC G9YR99.1
#=GS D6EAZ3_9ACTN/187-348  AC D6EAZ3.1
#=GS SAHH_PROM0/233-392    AC A3PFB5.1
#=GS C8Z746_YEAS8/194-355  AC C8Z746.1
#=GS H0KN76_9FLAO/196-357  AC H0KN76.1
#=GS SAHH_PSEPG/199-381    AC B0KM00.1
#=GS C1MNU4_MICPC/243-405  AC C1MNU4.1
#=GS A8MA18_CALMQ/205-367  AC A8MA18.1
#=GS A4FXV3_METM5/205-365  AC A4FXV3.1
#=GS C1DD32_LARHH/231-390  AC C1DD32.1
#=GS E2QXS7_CANFA/196-357  AC E2QXS7.1
#=GS H2B0E7_KAZAF/194-355  AC H2B0E7.1
#=GS A5C5K3_VITVI/240-403  AC A5C5K3.1
#=GS A2AXF5_STRCM/245-407  AC A2AXF5.1
#=GS F0BRC1_9XANT/238-400  AC F0BRC1.1
#=GS A4S2R4_OSTLU/238-400  AC A4S2R4.1
#=GS D9U9X3_TARRO/7-24     AC D9U9X3.1
#=GS H2GEU4_CORDP/236-398  AC H2GEU4.1
#=GS F0GQT0_9LACO/182-330  AC F0GQT0.1
#=GS H2KW56_ORYSJ/205-368  AC H2KW56.1
#=GS A4BSC4_9GAMM/232-393  AC A4BSC4.1
#=GS F0S4U8_PEDSD/211-372  AC F0S4U8.1
#=GS G7U2B4_CORPS/237-399  AC G7U2B4.1
#=GS E4WK76_RHOE1/250-412  AC E4WK76.1
#=GS F4B745_ACIHW/182-343  AC F4B745.1
#=GS Q2S8K2_HAHCH/176-336  AC Q2S8K2.1
#=GS I0WK18_9FLAO/197-358  AC I0WK18.1
#=GS D2Z418_9BACT/185-346  AC D2Z418.1
#=GS B1TB44_9BURK/233-392  AC B1TB44.1
#=GS A5WSG3_MYCTF/253-415  AC A5WSG3.1
#=GS C3MBA9_RHISN/244-403  AC C3MBA9.1
#=GS G8XUN4_CRAAR/192-353  AC G8XUN4.1
#=GS A3ZY00_9PLAN/208-376  AC A3ZY00.1
#=GS A2TXS3_9FLAO/196-355  AC A2TXS3.1
#=GS C1G4M0_PARBD/194-355  AC C1G4M0.1
#=GS I1ILT6_BRADI/210-373  AC I1ILT6.1
#=GS Q9SDP1_ALLCE/240-312  AC Q9SDP1.1
#=GS Q5D6C4_ARATH/240-403  AC Q5D6C4.1
#=GS F0E2N6_9PSED/199-381  AC F0E2N6.1
#=GS G2QZW2_THITE/194-355  AC G2QZW2.1
#=GS F2ZF75_9PSED/199-381  AC F2ZF75.1
#=GS H2JWF6_STRHJ/320-479  AC H2JWF6.1
#=GS F5RFA1_9RHOO/230-389  AC F5RFA1.1
#=GS F6E5X4_SINMK/227-386  AC F6E5X4.1
#=GS F6W2Q9_ORNAN/263-424  AC F6W2Q9.1
#=GS E5SHK1_TRISP/163-324  AC E5SHK1.1
#=GS A5K9E9_PLAVS/233-395  AC A5K9E9.1
#=GS SAHH_MYCUA/250-412    AC A0PRF5.1
#=GS Q1HPU7_BOMMO/190-350  AC Q1HPU7.1
#=GS G4HE74_9BACL/190-351  AC G4HE74.1
#=GS Q1EMV4_STRCT/247-409  AC Q1EMV4.1
#=GS SAHH_METKA/190-352    AC P58855.1
#=GS F6TAH9_MACMU/275-436  AC F6TAH9.1
#=GS A1R4D6_ARTAT/240-406  AC A1R4D6.1
#=GS B2HV18_ACIBC/197-372  AC B2HV18.1
#=GS B6K4J5_SCHJY/192-353  AC B6K4J5.1
#=GS D0D9Z9_9RHOB/223-382  AC D0D9Z9.1
#=GS SAHH_BDEBA/219-379    AC Q6MNC0.2
#=GS D4S8K5_9FIRM/184-345  AC D4S8K5.1
#=GS C9LLJ6_9FIRM/185-346  AC C9LLJ6.1
#=GS E5Y7L4_BILWA/235-397  AC E5Y7L4.1
#=GS A9AD50_BURM1/233-392  AC A9AD50.1
#=GS D8D0S9_COMTE/236-395  AC D8D0S9.1
#=GS E7EI18_PIG/289-450    AC E7EI18.1
#=GS B3NZB0_DROER/252-413  AC B3NZB0.1
#=GS B7GU74_BIFLS/176-335  AC B7GU74.1
#=GS D7H0J7_BRUAO/231-390  AC D7H0J7.1
#=GS A6NRR9_9FIRM/183-344  AC A6NRR9.1
#=GS G1MUY3_MELGA/266-427  AC G1MUY3.2
#=GS D2RTK5_HALTV/194-355  AC D2RTK5.1
#=GS H3Q7M4_BRUAO/227-386  AC H3Q7M4.1
#=GS H1K5S5_9MYCO/250-412  AC H1K5S5.1
#=GS SAHH_CAEEL/193-354    AC P27604.1
#=GS G8UYF5_LEGPN/155-280  AC G8UYF5.1
#=GS Q84VE1_ORYSJ/240-403  AC Q84VE1.1
#=GS F1NSH8_CHICK/247-408  AC F1NSH8.1
#=GS H6M6L3_CORPS/237-399  AC H6M6L3.1
#=GS B3E1J2_GEOLS/225-384  AC B3E1J2.1
#=GS B7B766_9PORP/232-394  AC B7B766.1
#=GS D1RN63_SEROD/175-324  AC D1RN63.1
#=GS D9IUM4_DUNSA/241-403  AC D9IUM4.1
#=GS A0LCX4_MAGSM/202-361  AC A0LCX4.1
#=GS G0Q4S5_STRGR/243-405  AC G0Q4S5.1
#=GS G5BH87_HETGA/249-410  AC G5BH87.1
#=GS F7H743_CALJA/289-450  AC F7H743.1
#=GS B9BC65_9BURK/233-392  AC B9BC65.1
#=GS Q5CBJ7_9THEM/174-335  AC Q5CBJ7.1
#=GS D0SMK7_ACIJU/197-372  AC D0SMK7.1
#=GS F6XCK4_CIOIN/193-354  AC F6XCK4.1
#=GS SAHH2_ARATH/240-403   AC Q9LK36.1
#=GS E8TYU5_ALIDB/235-395  AC E8TYU5.1
#=GS A3CT79_METMJ/175-334  AC A3CT79.1
#=GS SAHH3_MOUSE/372-533   AC Q68FL4.1
#=GS F9ILB0_ACIBA/197-372  AC F9ILB0.1
#=GS B0D6M5_LACBS/189-350  AC B0D6M5.1
#=GS D0L2C5_GORB4/248-409  AC D0L2C5.1
#=GS H0EQE2_GLAL7/194-355  AC H0EQE2.1
#=GS E6W439_DESIS/191-354  AC E6W439.1
#=GS F7WLN7_MYCTC/253-415  AC F7WLN7.1
#=GS G0JXV2_STEMA/239-401  AC G0JXV2.1
#=GS Q2RKL5_MOOTA/185-346  AC Q2RKL5.1
#=GS A9HFJ7_GLUDA/208-367  AC A9HFJ7.1
#=GS F2R531_STRVP/242-404  AC F2R531.1
#=GS H1J016_9BACT/241-403  AC H1J016.1
#=GS F5HDZ4_CRYNB/190-351  AC F5HDZ4.1
#=GS D6KCS4_9ACTO/283-441  AC D6KCS4.1
#=GS C4XAU3_KLEPN/185-334  AC C4XAU3.1
#=GS E8UEX5_TAYEM/226-385  AC E8UEX5.1
#=GS G6I300_9FIRM/185-346  AC G6I300.1
#=GS B3M7H8_DROAN/280-441  AC B3M7H8.1
#=GS F3FKL5_PSESX/199-381  AC F3FKL5.1
#=GS B9DG03_ARATH/240-311  AC B9DG03.1
#=GS C6B127_RHILS/227-386  AC C6B127.1
#=GS F3EQA7_9PSED/12-120   AC F3EQA7.1
#=GS G3IV00_9GAMM/191-350  AC G3IV00.1
#=GS D8TV30_VOLCA/239-401  AC D8TV30.1
#=GS D6K2H1_9ACTO/243-405  AC D6K2H1.1
#=GS F1S610_PIG/264-389    AC F1S610.1
#=GS F9G541_FUSOF/194-355  AC F9G541.1
#=GS C1AEG7_GEMAT/254-416  AC C1AEG7.1
#=GS Q39W44_GEOMG/237-396  AC Q39W44.1
#=GS G5H844_9BACT/230-392  AC G5H844.1
#=GS D9U9W8_DASGE/7-24     AC D9U9W8.1
#=GS D9QET1_CORP2/237-399  AC D9QET1.1
#=GS H2L3W2_ORYLA/256-417  AC H2L3W2.1
#=GS A1WT33_HALHL/181-342  AC A1WT33.1
#=GS E7NH20_YEASO/194-355  AC E7NH20.1
#=GS H3C7K6_TETNG/1-44     AC H3C7K6.1
#=GS SAHH_BURPS/234-393    AC Q63PT2.1
#=GS C1DIC0_AZOVD/195-377  AC C1DIC0.1
#=GS C5MJ06_CANTT/195-356  AC C5MJ06.1
#=GS A4AKG7_9ACTN/155-316  AC A4AKG7.1
#=GS E6QSP3_9ZZZZ/231-390  AC E6QSP3.1
#=GS SAHH_NITEU/239-398    AC Q82WL1.1
#=GS H0UIN7_9BACT/184-345  AC H0UIN7.1
#=GS E0Q8K3_9BIFI/253-412  AC E0Q8K3.1
#=GS G3C8Z5_PINPS/240-403  AC G3C8Z5.1
#=GS C6WT31_METML/235-394  AC C6WT31.1
#=GS F8ESY2_ZYMMT/225-384  AC F8ESY2.1
#=GS D4VQJ0_9BACE/129-291  AC D4VQJ0.1
#=GS F7XPU3_METZD/181-341  AC F7XPU3.1
#=GS B5YDL3_DICT6/183-344  AC B5YDL3.1
#=GS G2KMU1_MICAA/198-357  AC G2KMU1.1
#=GS E5UGA5_ALCXX/232-391  AC E5UGA5.1
#=GS D3K115_LEIDO/190-351  AC D3K115.1
#=GS H3D3K6_TETNG/249-410  AC H3D3K6.1
#=GS E4LG26_9FIRM/160-321  AC E4LG26.1
#=GS G3I359_CRIGR/121-281  AC G3I359.1
#=GS C3MVE6_SULIM/203-364  AC C3MVE6.1
#=GS D4WID0_BACOV/232-394  AC D4WID0.1
#=GS G4DD58_9GAMM/233-392  AC G4DD58.1
#=GS F0KJ86_ACICP/197-372  AC F0KJ86.1
#=GS B3RVD8_TRIAD/192-352  AC B3RVD8.1
#=GS F0QW72_VULM7/204-366  AC F0QW72.1
#=GS E8RFG5_DESPD/189-348  AC E8RFG5.1
#=GS D6K019_9ACTO/169-279  AC D6K019.1
#=GS D7VJS1_9SPHI/197-358  AC D7VJS1.1
#=GS F4CE42_SPHS2/197-358  AC F4CE42.1
#=GS C8SY61_KLEPR/177-292  AC C8SY61.1
#=GS A8A8H2_IGNH4/185-346  AC A8A8H2.1
#=GS Q7QE71_ANOGA/216-379  AC Q7QE71.4
#=GS H0PMZ0_9SYNC/192-353  AC H0PMZ0.1
#=GS G7MMC3_MACMU/263-424  AC G7MMC3.1
#=GS D4T0E5_9XANT/238-400  AC D4T0E5.1
#=GS G4G5E2_9EURY/196-357  AC G4G5E2.1
#=GS A1RXU1_THEPD/201-362  AC A1RXU1.1
#=GS H2V9F7_TAKRU/90-128   AC H2V9F7.1
#=GS C7RKF9_ACCPU/230-389  AC C7RKF9.1
#=GS D3ZI25_RAT/267-428    AC D3ZI25.1
#=GS H9KFS9_APIME/291-452  AC H9KFS9.1
#=GS H2PNH5_PONAB/264-425  AC H2PNH5.1
#=GS F8SMB9_SOYBN/240-403  AC F8SMB9.1
#=GS D0S1Y2_ACICA/197-372  AC D0S1Y2.1
#=GS E7PI10_PSESG/199-381  AC E7PI10.1
#=GS F5Z9H3_ALTSS/173-329  AC F5Z9H3.1
#=GS SAHH3_PONAB/267-428   AC Q5R889.1
#=GS F4HN80_PYRSN/188-349  AC F4HN80.1
#=GS B5EN12_ACIF5/196-380  AC B5EN12.1
#=GS E2NDS5_9BACE/247-409  AC E2NDS5.1
#=GS Q9XEI8_ALEFU/12-173   AC Q9XEI8.1
#=GS C9S873_VERA1/46-207   AC C9S873.1
#=GS H1RZD4_9BURK/231-339  AC H1RZD4.1
#=GS C5NZ90_COCP7/194-355  AC C5NZ90.1
#=GS SAHH_MYCLB/250-412    AC B8ZQE9.1
#=GS SAHH_GRABC/199-358    AC Q0BW40.1
#=GS E9ATH3_LEIMU/190-351  AC E9ATH3.1
#=GS H2HYL1_CORDP/236-398  AC H2HYL1.1
#=GS G4HVG0_MYCRH/244-406  AC G4HVG0.1
#=GS F9MPQ0_9FIRM/184-345  AC F9MPQ0.1
#=GS SAHH_HALSA/192-353    AC Q9HN50.1
#=GS H0G4B4_RHIML/227-386  AC H0G4B4.1
#=GS Q5ZTI9_LEGPH/155-280  AC Q5ZTI9.1
#=GS D0P9U4_BRUSS/227-386  AC D0P9U4.1
#=GS G4GJL3_9EURY/194-355  AC G4GJL3.1
#=GS SAHH_NITEC/239-398    AC Q0AEV8.1
#=GS A6EZ71_9ALTE/200-376  AC A6EZ71.1
#=GS E4Y2K1_OIKDI/8-109    AC E4Y2K1.1
#=GS A1HM83_9FIRM/184-345  AC A1HM83.1
#=GS SAHH_MYCTA/253-415    AC A5U7S2.1
#=GS E7S070_9BURK/229-388  AC E7S070.1
#=GS B5IFG3_ACIB4/158-318  AC B5IFG3.1
#=GS I0KX66_9ACTO/257-419  AC I0KX66.1
#=GS H8HYL5_MYCTU/253-415  AC H8HYL5.1
#=GS G3ASF9_SPAPN/194-355  AC G3ASF9.1
#=GS F8W7N8_HUMAN/289-450  AC F8W7N8.1
#=GS G3BMH9_9BACT/186-347  AC G3BMH9.1
#=GS E3QXV6_COLGM/194-355  AC E3QXV6.1
#=GS E4V0W0_ARTGP/194-355  AC E4V0W0.1
#=GS Q21NJ6_SACD2/203-379  AC Q21NJ6.1
#=GS D6F9P7_MYCTU/253-415  AC D6F9P7.1
#=GS H1L3U5_GEOME/237-396  AC H1L3U5.1
#=GS Q4H1G1_BETVU/242-405  AC Q4H1G1.1
#=GS B3EKD4_CHLPB/232-394  AC B3EKD4.1
#=GS D4X4T5_9BURK/232-391  AC D4X4T5.1
#=GS E1YH08_9DELT/244-406  AC E1YH08.1
#=GS Q9VZX9_DROME/280-441  AC Q9VZX9.1
#=GS G6GCE3_9FIRM/186-347  AC G6GCE3.1
#=GS E3WNT2_ANODA/216-379  AC E3WNT2.1
#=GS C9U6K1_BRUAO/227-386  AC C9U6K1.1
#=GS G6X2K4_MYCAB/244-406  AC G6X2K4.1
#=GS A5DIF6_PICGU/194-355  AC A5DIF6.1
#=GS C7L8M7_ACEPA/189-348  AC C7L8M7.1
#=GS F6Q7C2_HORSE/289-450  AC F6Q7C2.1
#=GS H3CM65_TETNG/192-352  AC H3CM65.1
#=GS F1QFK1_DANRE/382-543  AC F1QFK1.1
#=GS G4LX03_SCHMA/191-352  AC G4LX03.1
#=GS H3EHZ4_PRIPA/191-351  AC H3EHZ4.1
#=GS Q2IMA1_ANADE/251-411  AC Q2IMA1.1
D0SWS3_ACILW/197-372             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nvD.........L............L...Q...............N........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......En......eN.............D....Y........LILLSE..GRLVNLGNATG...........................................................................
F4F6A8_VERMA/257-419             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....M.....AV.VL.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.V.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............V...E...............I........A.....D...I.....F.....I....T....A.....T....G....C....F...D....VI...TN.E.HM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKR...sDV..........T.R.EN.I.K.P......Q......VD...L.........W..........K........F........D......D........G.............H....A........IIVLSE..GRLLNLGNATG...........................................................................
E4YV13_OIKDI/193-267             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....C.....AI.VA.G.Y.G.D.............VGKGSAL.SLK.AFG.C...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........T...M....E......G.......F....Q.....V.....C.............Y.............L.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------kin........................................................................
B6JBB2_OLICO/231-390             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............Q........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.T.L.KNM....--..........K.W.TN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............K....R........MILLSE..GRLVNLGNAMG...........................................................................
H0X9M4_OTOGA/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.IC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
H0HKT9_9RHIZ/226-385             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSSA.SLK.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......E............D.........A............A...P...............T........A.....D...I.....V.....I....T....T.....T....G....N....K...D....VI...TL.D.HM.R.M..MKD.MV..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.I.K.P......Q......VD...M.........I..........S........F........P......D........G.............K....R........MILLSE..GRLLNLGNATG...........................................................................
E0I3E5_9BACL/190-351             ..............................NRYGTGQSVF..DGI...N....R..T..T.N.L...V...VSG...K.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.V.....V..T.....E...I..D.......A....I...K........A......V....E....A.........Y...M....D......G.......F....A.....V.....M.............P.............M.......I............D.........A............A...K...............V........G.....D...I.....F.....V....T....V.....T....G....N....R...D....VI...RG.E.HY.E.V..MKN.GA..IL..S.N.....A...G..H...FD..VEV.N.....K..P.E.L.EAL....ST..........N.V.RT.V.R.K......N......IE...E.........Y..........K........L........K......D........G.............R....S........IYLLAE..GRLVNLAAG--dg.........................................................................
F7YX09_9THEM/174-335             ..............................NRYGTGQSTL..ESI...M....R..N..T.N.L...S...ICG...K.....T.....VV.VC.G.Y.G.W.............CGKGIAQ.RAK.GLG.A...R...V.I.....V..T.....E...V..D.......P....I...K........A......L....E....A.........V...M....E......G.......F....Q.....V.....M.............P.............I.......K............E.........A............A...K...............V........G.....D...I.....F.....I....T....A.....T....G....N....K...N....VI...SV.E.EF.L.V..MKN.NA..IL..A.N.....A...G..H...FN..VEI.D.....I..K.A.L.EEL....AV..........E.K.YE.A.R.P......N......VT...G.........Y..........V........L........E......N........G.............N....T........LFLLAE..GRLVNLAAAD-g..........................................................................
D5WSA8_BACT2/188-348             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...V...VAG...K.....T.....AV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...R...V.V.....V..C.....E...V..N.......P....I...K........A......I....E....A.........I...M....D......G.......F....A.....V.....M.............P.............L.......V............E.........A............S...R...............E........A.....D...F.....V.....I....T....V.....T....G....N....R...G....VV...GK.E.AV.A.E..MKD.GA..VL..C.N.....A...G..H...FD..VEI.D.....K..E.A.L.GEA....G-..........P.P.RE.V.R.R......N......VQ...E.........Y..........R........Q........R......D........G.............R....R........LYLLAE..GRLVNLAAG--dg.........................................................................
G2P959_STRVO/168-324             ......................qsvvfste----------..-AL...L....R..G..R.G.D...I...LHG...R.....P.....AL.VL.G.F.G.K.............LGSSIAR.LLH.AKG.I...H...V.T.....V..Y.....D...V..S.......P....V...R........R......A....Q....A.........L...S....Q......G.......F....G.....V.....A.............R............dR.......D............H.........A............L...T...............Q........A.....G...L.....V.....L....C....A.....T....G....S....L...S....-L...RG.E.DF.P.Q..LRN.GA..YV..A.T.....V...T..S...SE..DEL.E.....L..D.G.L.PDS....-Y..........T.R.SA.A.G.D......G......IT...R.........Y..........-........L........A......T........G.............H....Y........FYLLNN..GNAVNF-----lhsas......................................................................
Q80TQ9_MOUSE/237-398             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
E4W1B4_BACFG/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............D.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...pGI..........K.R.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
A4CIU7_ROBBH/197-358             ..............................NKYGCKESAV..DAI...R....R..A..T.D.T...M...LAG...K.....R.....VV.VM.G.Y.G.D.............VGKGTAA.SFR.GAG.A...I...V.T.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....E.....V.....K.............K.............L.......E............T.........V............V...S...............Q........M.....D...I.....L.....I....T....A.....T....G....N....R...D....II...RE.E.HF.A.A..MKD.KA..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NTH...yGH..........T.R.DE.I.K.P......Q......VD...K.........Y..........T........L........-......D........G.............K....D........IIVLAE..GRLVNLGCATG...........................................................................
G1QTF9_NOMLE/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
A5E357_LODEL/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALQ.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....A.............P.............L.......D............E.........V............A...S...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...VG.K.HF.E.K..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AE..........S.V.VN.I.K.P......Q......VD...R.........Y..........L........M........K......N........G.............R....H........IILLAD..GRLVNLGCATG...........................................................................
C5LXA1_PERM5/232-396             ..............................NVYGCRHSLP..DGI...M....R..A..T.D.V...M...IGG...K.....T.....VF.VA.G.Y.G.D.............VGKGCAV.AMK.GCG.A...K...V.L.....V..G.....E...I..D.......P....I...C........A......L....Q....A.........C...M....E......G.......L....T.....V.....T.............T.............I.......E............D.........A............I...S...............Ky......nA.....D...I.....F.....I....T....A.....T....G....N....K...D....IV...TL.E.HM.E.A..MKN.NA..IV..G.N.....I...G..H...FD..NEI.Q.....M..E.R.L.ENC...pGV..........K.C.MN.I.K.P......Q......VD...R.........F..........E........F........P......D........G.............H....G........IIMLAS..GRLLNLGCATG...........................................................................
G8F3A9_MACFA/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
B4EE70_BURCJ/233-392             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
A5IDK4_LEGPC/202-361             ..............................NLYGCRESLL..DGL...K....R..A..T.D.V...M...IAG...K.....V.....AL.IL.G.Y.G.D.............VGKGCAQ.ALR.GQG.A...T...V.L.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............L.......D............D.........V............A...E...............Q........V.....D...I.....V.....V....T....A.....T....G....N....Y...H....VV...TH.D.HM.K.R..MRN.QA..IL..C.N.....I...G..H...FD..SEI.D.....I..Q.S.L.KQY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IIILAE..GRLVNLGCATG...........................................................................
SAHH_POLSQ/235-399               ..............................NLYGCRESLV..DAI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...D...............K........A.....D...I.....F.....V....S....A.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKN.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.G.I.EKY....--..........K.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......Aan...gkpE.............K....R........IIILAK..GRLVNLGCGTG...........................................................................
D3PEF1_DEFDS/185-347             ..............................NRYGTGQSTL..DGI...I....R..A..T.D.V...L...LAG...K.....V.....FV.VA.G.Y.G.W.............CGRGLAE.RAR.GMG.A...N...V.I.....V..T.....E...V..N.......P....I...R........A......L....E....A.........A...M....D......G.......F....R.....V.....M.............K.............M.......I............D.........A............V...K...............E........A.....D...I.....V.....C....T....V.....T....G....D....I...H....VL...RR.E.HF.E.V..MKD.GC..YI..C.N.....S...G..H...FD..VEI.D.....I..P.A.L.ESL....AT..........EiN.KN.V.R.N......F......VD...E.........Y..........V........L........K......D........G.............R....K........LYLLAE..GRLVNLGAAEG...........................................................................
E1LAM8_9FIRM/184-345             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...T...VAG...K.....N.....VV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...H...V.F.....V..T.....E...V..D.......P....I...K........A......I....E....A.........V...F....D......G.......F....T.....V.....L.............P.............M.......I............E.........A............A...K...............I........G.....D...I.....F.....C....T....V.....T....G....C....K...D....VI...VK.E.HY.E.V..MKD.KA..VL..C.N.....A...G..H...FD..CEV.N.....V..H.D.L.EQV....AV..........S.H.ER.V.R.Q......N......IE...G.........Y..........T........M........A......D........G.............R....K........LYVLAE..GRLVNLAAG--dg.........................................................................
SAHHB_XENLA/192-353              ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.AFG.A...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............S...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....A...D....IV...EG.R.HF.E.N..MKD.DS..IV..C.N.....I...G..H...FD..VEL.D.....V..K.W.L.NDN....AA..........K.K.IN.I.K.P......Q......VD...R.........Y..........L........L........K......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
A1L1P3_DANRE/256-417             ..............................NLYCCRESIL..DSL...K....K..T..A.D.I...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCSA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....T.............K.............L.......S............D.........V............V...R...............Q........V.....D...M.....V.....I....T....C.....T....G....N....K...N....VV...VR.E.HM.D.V..MKN.GC..VV..C.N.....M...G..R...SN..TEI.N.....V..S.A.L.KTP....DL..........T.W.QH.V.R.A......Q......VD...H.........I..........I........W........P......D........G.............K....R........IILLAE..GRVLNLSSST-v..........................................................................
H8GMC4_METAL/190-349             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VC.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............E.........A............A...P...............L........A.....N...I.....F.....V....T....A.....T....G....N....V...N....VI...TH.Q.HM.Q.A..MKN.QA..IV..C.N.....I...G..H...FD..SEI.D.....I..A.S.L.RQY....--..........T.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........LIVLAE..GRLVNLGCATG...........................................................................
Q5D6C5_ARATH/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.IC.G.Y.G.D.............VGKGCAA.AMK.TAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tK.............A....G........IIVLAE..GRLMNLGCATG...........................................................................
A0JCJ9_PLUXY/190-350             ..............................NLYGCRESLL..DGI...K....R..A..T.D.I...M...VAG...K.....V.....CV.VA.G.Y.G.D.............VGKGCAQ.AFK.GFG.G...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....Q.....V.....T.............T.............M.......E............E.........A............A...E...............V........G.....Q...I.....F.....V....T....T.....T....G....N....L...D....II...TK.D.HF.L.R..MRD.DV..IV..C.N.....I...G..H...FD..CEV.D.....V..A.W.L.ENN....-A..........K.K.VN.I.K.P......Q......VD...R.........Y..........E........L........E......N........G.............N....H........IIVLAA..GRLVNLGCATG...........................................................................
F8JPG0_STREN/247-409             ..............................NRYGVRHSLV..DGI...N....R..G..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.ALR.GQG.A...K...V.T.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....P.....V.....A.............T.............L.......E............D.........M............L...P...............T........A.....D...I.....V.....I....T....A.....T....G....N....R...D....IV...RV.E.HM.A.A..MKH.LA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AGF...pGI..........R.R.VN.I.K.P......Q......VD...Q.........W..........T........F........P......D........G.............H....A........VLVLSE..GRLLNLGNATG...........................................................................
C4Y0X4_CLAL4/240-401             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALH.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....A.............P.............M.......E............E.........V............A...S...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...TG.E.HF.N.Q..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....CE..........S.V.VN.I.K.P......Q......VD...R.........Y..........L........M........K......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
A3DN18_STAMF/185-347             ..............................NRYGTGQSTF..DGI...L....R..A..T.N.I...L...VAG...K.....V.....VV.VA.G.Y.G.W.............VGRGIAM.RAR.GLG.A..rR...V.I.....I..T.....E...V..D.......P....I...R........A......L....E....A.........V...F....D......G.......F....E.....V.....M.............P.............M.......I............K.........A............A...E...............V........G.....D...I.....F.....I....T....A.....T....G....N....K...A....VI...RK.E.HI.E.K..MKD.GA..IL..A.N.....A...G..H...FN..VEI.W.....I..P.D.L.ESL....SM..........N.K.RV.I.R.P......N......VT...E.........Y..........K........L........R......D........G.............R....R........IYLLAK..GRLVNLVAAE-g..........................................................................
SAHH_BRUC2/227-386               ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
A6EPZ2_9BACT/197-356             ..............................NKYGCRESAV..DAI...R....R..A..T.D.I...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFK.GAG.A...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............K.............L.......E............T.........I............V...P...............N........A.....D...I.....V.....I....T....T.....T....G....N....K...D....IV...RP.E.HF.E.A..MKD.KT..IV..C.N.....I...G..H...FD..NEI.D.....V..P.W.L.NKN....A-..........V.K.DE.I.K.P......Q......VD...K.........Y..........T........F........-......N........G.............K....D........IVLLAE..GRLVNLGCATG...........................................................................
A3KAZ8_9RHOB/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............L.............L.......E............D.........V............V...D...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............S....R........LILLSE..GRLLNLGNATG...........................................................................
D5EF23_AMICL/184-345             ..............................NRYGTGQSVM..DGL...M....R..T..T.N.M...L...IAG...K.....R.....VV.VA.G.Y.G.W.............CGRGVAM.RAQ.SMG.A...S...V.I.....V..V.....E...V..D.......P....H...R........A......F....E....A.........L...M....D......G.......H....Q.....V.....M.............N.............M.......E............E.........A............A...S...............L........G.....D...I.....F.....L....T....L.....T....G....N....T...Q....VI...RK.E.HF.Q.H..MKS.GA..IL..A.N.....A...G..H...FD..VEI.S.....K..R.D.L.SEM....AR..........S.I.ES.T.R.Q......N......IE...T.........Y..........E........L........R......D........G.............R....F........LHLLGE..GRLVNLACADG...........................................................................
A5D1G7_PELTS/185-346             ..............................NRYGTGESAW..SGI...M....R..T..T.N.L...V...VAG...K.....T.....VV.VL.G.Y.G.W.............CGKGVAM.RAR.GLG.A...R...V.I.....V..C.....E...V..D.......P....V...R........A......I....E....A.........C...M....D......G.......Y....Q.....V.....M.............G.............S.......E............D.........A............A...G...............Q........G.....D...I.....F.....I....T....V.....T....G....C....R...D....VL...RR.Q.HF.E.R..MKD.GA..VL..A.N.....A...G..H...FD..VEI.S.....K..P.D.L.AGL....AV..........E.R.RL.A.R.Q......N......IE...E.........F..........T........M........P......D........G.............R....K........IYLLAE..GRLVNLAAG--dg.........................................................................
B4SJZ9_STRM5/239-401             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...L.....Y.....V....T....T.....T....G....N....K...D....II...RI.E.HL.S.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.VGF...kGV..........Q.H.VN.I.K.P......Q......VD...K.........Y..........I........F........P......N........G.............N....A........IFLLAE..GRLVNLGCATG...........................................................................
G3A3E3_9RALS/231-390             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AI.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.V.EQY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....K........IIILAK..GRLVNLGCATG...........................................................................
H3BKT5_MOUSE/163-324             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
D5QIU6_GLUHA/190-349             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............E.........G............A...P...............R........G.....D...I.....F.....V....T....A.....T....G....N....E...D....VI...TI.D.HM.R.A..MKN.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..N.A.L.RNF....--..........T.W.EN.I.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
SAHH_PSEU5/199-380               ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spy........kngI.......N............DgteasvdaaL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.G.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RQN....-W..........G.W.EE.V.K.P......Q......VH...K.........I..........H........Rtgk.tvdpT......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
A0KIP4_AERHH/167-321             ........................vvysae-------SLA..---...-....R..T..L.N.R...T...FNV...C.....Q.....AA.LF.G.Y.G.K.............VGRSIAR.ELR.CRN.L...H...L.E.....L..V.....E...T..D.......V....L...R........Q......V....E....A.........L...S....H......G.......F....K.....L.....V.............G.............K.......A............E.........A............L...G...............R........A.....E...L.....V.....I....C....S.....T....G....N....G...A....-L...DL.A.DL.Q.Q..LRP.GT..MV..A.S.....V...T..S...AD..DEF.A.....F..-.C.L.AQL....PW..........P.S.EE.V.C.P......H......VL...A.........L..........T........R........P......D........G.............S....T........IFLLNR..GEAVNF-----vhgav......................................................................
G3BD48_CANTC/138-299             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AV.VA.G.F.G.D.............VGKGCAM.ALR.GMG.A...K...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....E.....V.....L.............P.............M.......E............E.........V............A...S...............V........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...TG.E.HF.S.K..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AE..........S.V.VN.I.K.P......Q......VD...R.........F..........L........L........K......N........G.............R....H........VILLAE..GRLVNLGCATG...........................................................................
A5J5D7_BURML/235-394             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
Q5X3C6_LEGPA/155-279             .............................t-VFGCAESSH..QAI...Q....K..L..T.G.V...D...PTN...K.....N.....WL.IF.G.F.G.K.............IGRGLAY.FCL.EH-.-...Q...V.P.....V..T.....V...V..D.......Ss.vhQ...C........D......L....A....S.........N...Lg..iE......A.......Ir.peE.....H.....D.............K.............L.......E............K.........A............V...A...............K........A.....D...I.....I.....L....T....A.....T....G....G....K...N....IM...S-.K.YP.R.S..WFD.GK..IL..G.N.....L...G..L...HD..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------efgpnft....................................................................
E6S782_INTC7/236-398             ..............................NKYGCRHSLI..DGL...N....R..A..T.D.V...L...IGG...K.....M.....AV.VC.G.Y.G.D.............VGKGCAQ.SLA.GQG.A...R...V.V.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....Q.....V.....L.............R.............L.......E............D.........V............V...G...............Q........A.....D...I.....F.....I....T....T.....T....G....C....Y...D....VI...TA.D.HM.T.Q..MKN.KA..IV..A.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARV...pGV..........T.K.TE.I.K.P......Q......VH...E.........W..........S........F........D......N........G.............R....S........IIVLSE..GRLMNLGNATG...........................................................................
G2HB55_9DELT/238-400             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............K.........A............V...E...............E........G.....D...I.....F.....V....T....A.....T....G....N....Y...K....VI...TG.A.HM.E.A..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.Y.L.ETT...pGC..........T.C.LN.I.K.P......Q......VD...K.........W..........T........L........K......S........G.............R....S........IIVLAE..GRLVNLGCATG...........................................................................
D1R6Y3_9CHLA/201-364             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....T.....VV.IA.G.Y.G.D.............VGKGCAK.SMA.AFG.A...R...V.V.....I..C.....E...V..D.......P....I...C........A......Y....Q....A.........A...M....E......G.......F....R.....V.....L.............T.............M.......E............E.........V............A...P...............A........G.....D...I.....F.....I....T....A.....T....G....C....C...N....VI...TG.Q.HM.E.Q..MKH.QA..II..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.ENN...pNI..........R.K.DE.I.K.P......Q......VS...R.........Y..........T........W........D......S.......tG.............K....S........LILLAE..GRLVNLGCATG...........................................................................
Q3Z942_DEHE1/185-346             ..............................NRYGTGQSTL..DGI...T....R..A..T.N.F...L...WAS...K.....T.....VV.VV.G.Y.G.W.............CGHGVAM.RAK.GLG.A...H...I.I.....V..T.....E...V..D.......P....V...K........A......L....E....A.........V...M....D......G.......F....S.....V.....M.............P.............M.......A............E.........A............A...K...............A........G.....D...I.....F.....I....T....V.....T....G....D....K...H....VI...DA.N.HF.K.L..MKD.GA..TL..A.N.....S...G..H...FN..SEI.N.....I..P.A.L.ETL....AC..........G.K.ET.I.R.P......S......VE...E.........Y..........K........M........K......D........G.............R....R........IYLLGE..GRLINLAAAE-g..........................................................................
E7H0S9_9BURK/226-385             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VV.G.Y.G.D.............VGKGCAQ.ALR.ALA.A...Q...V.W.....V..V.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............F.........A............K...D...............K........A.....D...I.....F.....V....T....C.....T....G....N....V...R....VI...TH.E.HM.I.A..MKN.EA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.M.RQY....--..........P.W.EN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....R........IILLAE..GRLVNLGCATG...........................................................................
E0SP38_IGNAA/184-345             ..............................NRYGTGQSTV..DGI...L....R..A..T.N.T...L...IAG...K.....T.....VV.VA.G.Y.G.W.............VGRGIAL.RFR.GMG.A...N...V.I.....V..T.....E...V..N.......P....I...R........A......L....E....A.........V...M....D......G.......F....M.....V.....M.............K.............M.......S............E.........A............A...K...............L........G.....D...I.....F.....I....T....A.....T....G....N....I...N....VI...NR.Q.HF.E.L..MKD.GA..IL..A.N.....S...G..H...FD..VEI.N.....V..K.D.L.EAM....AI..........S.K.RD.L.R.E......C......VT...E.........Y..........V........L........P......N........G.............R....R........LYLLGR..GRLVNLVCAEG...........................................................................
D7G8Q4_ECTSI/236-396             ..............................NLYGCKHSLP..DGL...C....R..A..T.D.V...M...IAG...K.....S.....AV.VC.G.Y.G.D.............VGKGCAQ.AMK.AAG.A...I...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....R.....V.....V.............K.............L.......D............T.........V............V...K...............T........G.....D...I.....F.....I....T....T.....T....G....N....K...G....II...MA.T.DM.A.K..MKN.NA..IV..G.N.....I...G..H...FD..NEI.D.....L..A.G.L.VAT....-T..........K.Q.LN.I.K.P......Q......VD...K.........F..........I........F........D......D........G.............H....A........IILLAE..GRLLNLGCATG...........................................................................
B7K2I6_CYAP8/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....V.....VV.VA.G.Y.G.W.............CGKGVAM.RAR.GLG.S...N...V.I.....V..T.....E...I..N.......P....V...R........A......I....E....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......A............E.........A............A...T...............Q........G.....D...I.....F.....V....T....V.....T....G....N....K...H....VI...RA.E.HF.E.V..MKD.GA..MV..C.N.....S...G..H...FD..IEI.D.....L..K.S.L.GAK....AS..........E.V.KE.V.R.N......F......TQ...K.........Y..........T........L........P......N........G.............K....S........IVVLGE..GRLINLAAAE-g..........................................................................
H8E1L4_9MICO/246-413             ..............................NKYGIRHSLP..DGL...N....R..A..T.D.V...L...IGG...K.....V.....AY.VV.G.Y.G.D.............VGKGAAE.ALR.GQG.A...R...V.I.....I..G.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....A.............R.............L.......E............S.........V............I...G...............D........V.....D...I.....L.....I....T....G.....T....G....N....T...R....VV...TV.E.HL.Q.N..LKH.LA..IV..G.N.....V...G..H...FD..DEI.D.....M..A.G.L.EAI...aGV..........E.K.IE.I.K.P......Q......VH...E.........Y..........R........L........P......As......aGr..........apR....S........ILVMSE..GRLMNLGNATG...........................................................................
SAHH_PSEE4/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............SpfkdgintgteagI......nK............D.........L............L...G...............R........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKH....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........H........RtgagtfdpQ......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
G7CNC6_MYCTH/247-408             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....AL.VC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............Q.........A............I...A...............D........A.....D...I.....V.....I....T....A.....T....G....N....K...D....II...TL.E.HM.R.A..MKN.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........K.K.TN.I.K.P......Q......VD...L.........W..........T........F........E......D........G.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
G4M0M5_SCHMA/330-491             ..............................NFYLCKESIV..DSL...K....R..T..T.D.M...M...ISG...K.....T.....VL.VC.G.Y.G.E.............VGKGVCQ.ALR.GLG.A...F...V.C.....I..S.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......Y....R.....V.....V.............K.............I.......D............E.........V............I...R...............S........V.....D...I.....V.....V....T....C.....T....G....N....K...G....VI...TR.A.HM.D.Q..MKS.GC..VV..C.N.....M...G..H...SN..TEI.D.....V..R.S.L.QTP....DL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........M......D........G.............K....R........IVLIAE..GRLANLSCST-v..........................................................................
SAHH_PIG/191-352                 ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....I...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........L........L........K......N........G.............H....R........IILLAE..GRLVNLGCAMG...........................................................................
B3KUN3_HUMAN/163-324             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........V......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....I...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........R........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
D1AF40_THECD/186-348             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.T...L...LAG...K.....T.....IV.VA.G.F.G.Y.............CGRGLAE.RAR.GMG.A...R...V.V.....I..T.....E...I..D.......P....V...K........A......L....D....A.........V...L....Q......G.......F....T.....V.....A.............P.............M.......A............E.........A............A...E...............V........G.....D...V.....F.....I....T....A.....T....G....N....R...D....VI...TA.E.HF.A.V..MKD.GA..IL..A.N.....S...G..H...FD..VEI.D.....V..R.A.L.ADL....AV..........EvH.RD.V.R.P......Q......AD...E.........Y..........V........L........A......D........G.............R....R........LVLLAE..GRLVNLAAAE-g..........................................................................
G5H1D9_9FIRM/184-345             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.L...V...IAG...K.....T.....VV.IA.G.Y.G.W.............CGKGGAM.RAR.GLG.A...N...V.I.....I..T.....E...V..D.......P....I...K........A......I....E....A.........V...F....D......G.......F....Y.....V.....M.............P.............M.......D............E.........A............A...K...............V........G.....D...I.....F.....L....T....L.....T....G....N....K...D....IL...CK.R.HF.D.V..MKD.GA..MM..A.N.....S...G..H...FD..VEI.N.....I..P.E.L.TAC....SV..........S.N.EV.V.R.D......N......IR...E.........F..........V........Q........P......D........G.............R....R........LYLLAE..GRLVNLAAG--dg.........................................................................
I0LHG2_CORGL/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.VC.G.Y.G.D.............VGKGCAE.AFD.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......Y....S.....V.....V.............T.............V.......D............E.........A............I...E...............D........A.....D...I.....V.....I....T....A.....T....G....N....K...D....II...SF.E.QM.L.K..MKD.HA..LL..G.N.....I...G..H...FD..NEI.D.....M..H.S.L.LHR...dDV..........T.R.TT.I.K.P......Q......VD...E.........F..........T........F........S......T........G.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
A7HPA7_PARL1/233-392             ..............................NLYGCRESLV..DGI...R....R..A..T.D.V...M...MSG...K.....V.....GV.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............D.........A............A...P...............R........G.....D...I.....F.....V....T....T.....T....G....N....V...D....VI...TV.D.HM.R.K..MKH.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..G.G.L.RNL....--..........K.W.HN.V.K.P......Q......VD...E.........I..........E........F........Q......D........G.............K....R........IILLAE..GRLVNLGCGTG...........................................................................
C3NEA9_SULIY/209-370             ..............................NRYGTGQSAI..DGI...L....R..A..T.N.I...L...IAG...K.....I.....TV.VA.G.Y.G.W.............VGRGIAN.RLR.GMG.A...R...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........V...M....D......G.......F....D.....V.....M.............P.............I.......A............E.........A............S...K...............V........G.....D...I.....F.....V....T....A.....T....G....N....T...K....AI...RV.E.HM.L.N..MKD.GA..IL..S.N.....A...G..H...FN..VEV.D.....V..K.G.L.KET....AV..........K.V.RN.I.R.P......Y......VD...E.........Y..........T........L........P......N........G.............K....K........VYLLAD..GRLVNLAAAE-g..........................................................................
C9VJA1_9RHIZ/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
B0MW70_9BACT/234-395             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCAR.SMR.SYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....K.............T.............V.......E............S.........A............L...A...............E........G.....N...I.....Y.....V....T....C.....T....G....N....C...D....II...TL.E.HM.Q.R..MRD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....M..A.R.L.EAS....DA..........V.R.TN.I.K.P......Q......VD...K.........F..........T........F........L......D........G.............H....S........IFILAE..GRLVNLGCATG...........................................................................
G8UIE4_TANFA/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCAH.SMR.SYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........G............I...K...............E........G.....D...I.....F.....V....T....T.....T....G....N....C...D....VI...TI.D.HM.K.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..E.K.L.MTF...pGI..........K.H.QN.I.K.P......Q......VD...K.........Y..........T........F........P......D........G.............H....S........IFLLAE..GRLVNLGCATG...........................................................................
Q1AZH2_RUBXD/191-352             ..............................NRYGTGQSTL..AAL...M....Q..S..T.N.L...M...LGG...K.....R.....VV.VL.G.Y.G.W.............CGKGIAR.YAA.GLG.A...R...V.T.....V..C.....E...V..D.......P....V...R........G......L....E....A.........Y...A....D......G.......F....D.....V.....L.............P.............A.......L............R.........A............A...E...............V........G.....E...V.....F.....V....T....A.....T....G....N....R...R....VL...GE.E.HF.A.R..MRD.GA..LL..A.N.....A...G..G...VD..VEI.D.....V..G.W.L.RSA....AA..........R.V.RE.A.R.R......H......VE...E.........F..........V........M........P......D........G.............R....R........LRLVGG..GMVVNLTAG--dg.........................................................................
Q1K322_DESAC/231-393             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...VAG...K.....Q.....CV.VL.G.Y.G.D.............VGKGCAQ.AFR.GMG.A...M...V.S.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....E......G.......F....N.....V.....V.............D.............M.......D............E.........A............C...R...............W........G.....D...I.....F.....V....T....T.....T....G....N....V...D....VI...NR.S.HM.D.Q..MKD.QS..IV..C.N.....I...G..H...FD..SEI.Q.....V..E.S.L.FSD...dTL..........T.V.HE.I.K.P......Q......VD...Q.........I..........E........W........P......D........G.............K....R........ITLLAR..GRLVNLGCATG...........................................................................
F8JAK1_HYPSM/230-389             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.NAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TV.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.G.L.KNL....--..........K.W.TN.I.K.P......Q......VD...E.........I..........E........F........P......T........G.............R....R........IILLSE..GRLVNLGNAMG...........................................................................
C7R5W3_KANKD/150-277             ..........................tclg----TGEGVY..RAI...T....Q..I..A.N.I...D...LTN...K.....N.....IL.IF.G.Y.G.K.............VGIGIAY.YFS.KIT.P...N...I.I.....I..A.....E...A..D.......Re..rL...T........L......IehrgH....Q.........S...V....D......A.......K....Q.....S.....Q.............L.............I.......E............H.........A............A...E...............A........S.....D...L.....I.....I....T....A.....T....G....L....K...D....II...SD.N.YH.T.G..AFK.DK..LL..A.N.....A...G..A...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------edefgfafeas................................................................
A6FUY1_9RHOB/222-381             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....T.............L.............L.......E............D.........E............V...A...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
C8WGD8_EGGLE/185-346             ..............................NHYGTGQSTL..DGI...V....R..A..T.N.R...L...LCG...R.....T.....IV.IS.G.Y.G.Y.............CGSGLAL.RAK.GMG.M...R...V.I.....V..C.....E...V..D.......P....L...K........A......L....E....A.........H...M....E......G.......Y....E.....V.....M.............P.............A.......A............E.........A............A...R...............F........A.....D...V.....W.....V....T....V.....T....G....N....C...K....VV...DG.P.AF.E.N..MKD.GA..IV..C.N.....S...G..H...FD..SEI.N.....L..E.W.L.EDH....AT..........K.K.EE.I.K.P......L......VE...E.........Y..........T........L........P......D........G.............R....T........VIVLAQ..GRLVNLSCAEG...........................................................................
G7TDT7_9XANT/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.V.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KAL...kDV..........Q.K.IN.I.K.P......Q......VD...K.........Y..........V........F........P......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
SAHH1_ARATH/240-403              ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.IC.G.Y.G.D.............VGKGCAA.AMK.TAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tK.............A....G........IIVLAE..GRLMNLGCATG...........................................................................
C7DEZ5_9RHOB/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VM.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............L.............L.......E............D.........V............V...S...............T........A.....D...V.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............S....R........LILLSE..GRLLNLGNATG...........................................................................
H2H475_CORDP/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............H.............V.......D............Q.........A............I...G...............D........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.A..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHR...dDV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............K....S........IVVLSE..GRLLNLGNATG...........................................................................
H9F9K2_MACMU/303-464             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
H0YRF3_TAEGU/251-412             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......S............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RMP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
Q6KZJ7_PICTO/175-336             ..............................NRYGTGQSAL..DGF...M....N..A..T.N.I...L...IAG...K.....R.....IC.VI.G.Y.G.W.............VGRGIAM.RLK.GLG.A...I...V.T.....I..S.....E...V..D.......P....V...K........A......V....E....A.........L...M....D......G.......F....S.....V.....D.............T.............V.......E............N.........A............V...K...............Y........S.....D...I.....V.....F....T....A.....T....G....M....K...N....VV...PY.S.AL.L.K..AKN.GI..IL..G.N.....A...G..H...FN..NEI.D.....M..E.S.I.ESK....NI..........S.K.ER.V.R.D......Y......IT...E.........Y..........R........L........E......N........G.............N....R........INIISD..GRLLNLAAGQ-g..........................................................................
H0VJK0_CAVPO/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
E2VD69_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
E6ZM83_SPORE/188-349             ..............................NYYGCRESLV..DGI...K....R..A..T.D.V...M...LGG...K.....V.....AI.VA.G.F.G.D.............VGKGCAE.SLR.GYG.C...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........S...M....A......G.......Y....Q.....V.....D.............V.............M.......D............D.........V............A...S...............Q........A.....D...I.....F.....V....T....T.....T....G....C....R...D....II...TG.K.HF.E.A..MKD.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AA..........S.V.SN.I.K.P......Q......VD...R.........Y..........T........L........K......N........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
F0GLY3_9LACO/182-330             ........................adygtt----------..---...-....-..-..-.-.-...-...LLG...K.....K.....AL.VI.G.Y.G.K.............VGSSIAD.NLR.KRG.A...I...V.I.....V..A.....D...K..R.......A....I...R........L......A....N....A.........L...A....H......G.......Y....Q.....I.....T.............N............dI.......Y............T.........E............L...I...............D........I.....D...I.....V.....Y....I....A.....N....G....E....K...S....ID...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------alqlkkldlkhtlysfsvtsaddtfknsqiinelphyghnggyrilktksnktvilansgnainftysis.....
H2Z7I9_CIOSA/358-472             ..................ylkscspilqfi----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......L....T....G.........Y...M....D......G.......I....R.....V.....V.............R.............L.......H............E.........V............V...K...............T........A.....D...I.....F.....I....T....C.....S....G....N....K...N....VI...TR.E.SL.D.K..MKN.GA..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.KTN....DL..........T.W.EK.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
D7IX58_9BACE/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........A............V...K...............E........G.....N...I.....F.....V....T....T.....T....G....N....C...D....II...TI.E.HM.T.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.K.L.VNY...pNI..........K.H.TN.I.K.P......Q......VD...K.........Y..........T........F........P......N........G.............N....S........IFLLAE..GRLVNLGCATG...........................................................................
I1RNN2_GIBZE/194-323             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALH.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....Q.....V.....T.............T.............M.......E............K.........A............A...K...............F........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.E.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..C.L.A.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------qeerhfcpe..................................................................
SAHH_ROSDO/223-382               ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VM.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............L.............L.......E............D.........V............V...G...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.A..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......N........G.............N....R........LILLSE..GRLLNLGNATG...........................................................................
A3Z465_9SYNE/237-396             ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...VAG...K.....Q.....AL.VM.G.Y.G.D.............VGKGSAQ.SLR.GLG.A...T...V.C.....I..A.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............R.............L.......E............D.........V............V...D...............Q........M.....D...I.....F.....V....T....A.....T....G....N....Y...Q....VI...RN.E.HL.L.K..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KAY....--..........E.W.EN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....R........IILLAE..GRLVNLGCATG...........................................................................
SAHH_CORGB/236-398               ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.VC.G.Y.G.D.............VGKGCAE.AFD.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......Y....S.....V.....V.............T.............V.......D............E.........A............I...E...............D........A.....D...I.....V.....I....T....A.....T....G....N....K...D....II...SF.E.QM.L.K..MKD.HA..LL..G.N.....I...G..H...FD..NEI.D.....M..H.S.L.LHR...dDV..........T.R.TT.I.K.P......Q......VD...E.........F..........T........F........S......T........G.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
F9UZB5_MYCBO/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
D5C3N6_NITHN/188-349             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAS...K.....V.....FT.VV.G.Y.G.W.............CGRGIAR.RAQ.GHG.A...R...V.I.....I..T.....E...V..D.......P....L...R........A......L....E....A.........A...M....D......G.......F....A.....V.....M.............P.............L.......Q............E.........A............A...A...............C........S.....D...F.....M.....V....T....A.....T....G....D....K...H....VI...DK.A.HF.E.A..MKD.GC..IL..A.N.....S...G..H...FN..VEI.N.....L..P.A.L.EAL....AV..........D.K.RR.P.R.P......S......VD...E.........Y..........F........F........Q......D........G.............R....R........IRLLAE..GRLVNLAAAE-g..........................................................................
F6TZT1_CALJA/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....V...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........R........L........K......N........G.............H....R........IILLAE..GRLVNLGCAMG...........................................................................
G7DPR7_BRAJP/232-391             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....I..A.G.L.RNL....--..........K.W.TN.I.K.P......Q......VD...E.........I..........E........F........P......D........K.............H....R........IIMLSE..GRLVNLGNAMG...........................................................................
C2FX30_9SPHI/197-358             ..............................NKYGCRESLV..DAI...R....R..A..T.D.L...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAE.SLR.SAG.V...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....K.............K.............F.......A............D.........A............V...K...............E........A.....N...I.....V.....V....T....T.....T....G....N....K...D....IV...RA.E.HF.K.T..MKD.KT..VV..C.N.....I...G..H...FD..NEI.D.....V..A.W.L.NTN...yGN..........T.K.IE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............N....D........VILLAE..GRLVNLGCATG...........................................................................
Q4C723_CROWT/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.V...L...LAG...K.....V.....AV.VA.G.Y.G.W.............CGKGVAM.RAR.GLG.A...N...V.I.....V..T.....E...I..D.......P....V...R........A......I....E....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......A............E.........A............A...Q...............Q........G.....D...V.....F.....I....T....V.....T....G....N....K...H....VI...RP.E.HF.E.V..MKD.GA..MV..C.N.....S...G..H...FD..IEI.D.....L..E.S.L.GAK....AS..........E.V.KE.V.R.N......F......TQ...K.........Y..........T........L........P......S........G.............K....A........IVVLGE..GRLINLAAAE-g..........................................................................
C7YYH5_NECH7/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALH.GMG.A...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....Q.....V.....T.............T.............M.......E............K.........A............A...K...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.V.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AS..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........P......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
H7EV54_PSEST/199-380             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...LSG...K.....Q.....AL.VV.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spy........kdgI.......N............DgteasvdaaL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.G.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RAN....-W..........G.W.EE.V.K.P......Q......VH...K.........I..........H........Rtgk.svdpT......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
H2TA79_TAKRU/269-430             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........I............I...R...............Q........V.....D...V.....I.....I....T....C.....T....G....N....K...N....VV...TR.D.QL.D.R..MKN.GS..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............R....R........IILLAE..GRLLNLSCST-v..........................................................................
SAHH_HERAR/240-399               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.IA.G.Y.G.D.............VGKGSAQ.AMR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.A.L.KQY....--..........T.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCGTG...........................................................................
D9W3C2_9ACTO/239-401             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............V...E...............I........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.S.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKT...eGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
G7Z7L3_AZOL4/193-352             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.SQG.A...R...V.M.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....I.............T.............M.......D............E.........A............A...P...............L........G.....D...I.....F.....V....T....A.....T....G....N....V...D....VI...TI.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..D.A.L.RNL....--..........V.W.EE.V.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLAQ..GRLVNLGCATG...........................................................................
H8WE52_MARHY/200-376             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...LSG...K.....K.....AL.VI.G.Y.G.D.............VGKGSAL.SLR.QEG.M...I...V.K.....V..T.....E...A..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............SpyidgvntgteqgI......nK............D.........L............L...A...............N........T.....D...L.....L.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKS.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RKN....-W..........E.W.DE.V.K.P......Q......VH...V.........I..........Y........R........D......Ka......sN.............D....H........LILLSE..GRLVNLGNATG...........................................................................
F9X1E9_MYCGM/198-359             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....SV.VA.G.F.G.D.............VGKGCAE.ALH.SMG.A...R...V.L.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....Q.....V.....V.............T.............M.......E............E.........A............A...P...............I........A.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...VG.K.HF.E.A..MRE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KKN....AK..........E.V.VS.I.K.P......Q......VD...R.........F..........L........M........P......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
A8QBB7_BRUMA/165-326             ..............................NLYGIRESLP..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VA.G.Y.G.D.............VGKGAAA.SLR.AFG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............T.............L.......E............H.........V............A...S...............I........A.....N...I.....V.....V....T....T.....T....G....C....K...C....VV...RK.E.HM.I.E..MPE.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..N.W.L.NTN....AI..........S.R.DT.I.K.P......Q......VD...R.........Y..........Q........L........R......N........G.............R....H........IIVLAE..GRLCNLGCATG...........................................................................
B4G0V3_MAIZE/194-354             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.ALH.SMG.A...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...V....Q......G.......Y....E.....V.....N.............T.............M.......E............E.........A............A...K...............T........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.R.HF.E.A..MRN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AQ..........S.V.QN.I.K.P......Q......VD...R.........Y..........Q........L........-......N........G.............K....N........IILLAE..GRLVNLGCATG...........................................................................
A0ZN77_NODSP/192-311             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....N.....VV.VV.G.Y.G.W.............CGKGTAL.RAR.GMG.A...N...V.I.....V..T.....E...I..D.......P....I...K........A......I....E....A.........V...M....D......G.......F....R.....V.....L.............P.............M.......A............E.........A............A...T...............Y........G.....D...I.....F.....I....T....V.....T....G....N....K...H....VV...RG.E.HF.D.V..MKD.GA..IV..C.N.....S...G..H...FD..LEL.D.....L..N.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------t..........................................................................
C6W7Z5_ACTMD/249-411             ..............................NRYGIRHSLI..DGI...N....R..G..T.D.V...L...MGG...K.....V.....AV.IC.G.Y.G.D.............VGKGAAE.SLR.GQG.A...R...I.V.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........I...M....D......G.......Y....D.....V.....Q.............T.............L.......E............S.........V............L...P...............R........A.....D...I.....V.....I....T....T.....T....G....N....K...D....VV...RI.E.HM.A.A..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARF...pGV..........R.R.IN.I.K.P......Q......VD...E.........W..........V........F........P......D........G.............H....S........ILVLSE..GRLLNLGNATG...........................................................................
F9Z3R2_ODOSD/361-516             .......................qsvffsa----------..DAL...M....R..E..D.G.K...L...IQY...L.....K.....CG.IL.G.Y.G.K.............IGRSIAS.HLL.QRG.V...K...P.A.....V..Y.....D...T..N.......P....L...K........R......V....S....A.........F...N....E......L.......N....R.....I.....P.............D.............R.......D............S.........I............I...K...............E........S.....D...I.....L.....F....S....A.....T....G....N....K...S....-L...KI.E.DF.R.E..LKN.GC..YI..F.S.....V...T..S...SD..DEL.E.....L..E.F.T.GEY....--..........E.K.QE.V.R.K......H......IF...K.........Y..........S........N........E......N........M.............N....Y........FFLVND..GNAVNF-----iynav......................................................................
A8U0F7_9PROT/192-351             ..............................NLYGCRESLA..DGI...R....R..A..T.D.V...M...FSG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.GLR.NAG.A...R...V.I.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............E.........A............A...P...............M........A.....D...I.....F.....V....T....A.....T....G....N....K...D....VI...TI.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..TEI.Q.....I..G.A.L.RNY....--..........K.W.EN.V.K.P......Q......VD...E.........I..........V........F........P......D........G.............K....R........LIVLAE..GRLVNLGCATG...........................................................................
C5KQ92_PERM5/1-67                ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.-M.K.A..MKN.NA..IV..G.N.....I...G..H...FD..NEI.Q.....M..E.R.L.ETC...pGV..........K.C.MN.I.K.P......Q......VD...R.........F..........E........F........P......D........G.............H....G........IIMLAS..GRLLNLGCATG...........................................................................
SAHH_BURMA/234-393               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
Q83X57_STRRO/234-396             ..............................NKYGCRHSLV..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............L.......D............E.........V............V...E...............T........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.S.DM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARV...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............K....V........IIVLSE..GRLLNLGNATG...........................................................................
F8QXI7_9EUCA/27-85               ..............................NLYSCRESII..DSL...K....R..A..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCQ.ALK.GLG.C...T...V.Y.....V..T.....E...I..V.......P....L...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------qk.........................................................................
A8L9A5_FRASN/173-327             ..........................afsv----------..EKL...V....R..A..M.G.V...P...LFG...L.....N.....AG.IL.G.Y.G.R.............VGRNLAY.SLA.GRG.S...S...V.S.....V..Y.....D...S..D.......P....L...R........R......I....S....A.........A...A....D......G.......F....Q.....S.....V.............S.............R.......E............S.........V............V...Q...............T........S.....D...I.....I.....V....G....A.....T....G....N....T...S....LV...EM.D.-F.P.Q..LKH.RV..IL..A.S.....A...T..S...KR..AEF.A.....L..E.A.L.LAT....AD..........H.I.RR.V.N.D......G......VD...E.........I..........T........M........P......D........G.............R....R........IYVLTD..GEPVNFA----dgav.......................................................................
G1MTG4_MELGA/197-358             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.NFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....T...D....IV...QG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEV.D.....A..K.W.L.NQN....AV..........E.V.VN.V.K.P......Q......VD...R.........Y..........K........L........R......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
I1DHP5_9VIBR/187-349             ..............................NRFGVGSSVV..DGM...M....R..A..T.N.V...M...LHG...K.....K.....VV.VI.G.Y.G.Y.............CGSGTAQ.RLR.GMG.A...H...V.T.....V..V.....E...S..N.......S....L...T........K......L....E....A.........H...M....E......G.......F....Y.....T.....S.............T.............L.......E............K.........A............L...P...............D........A.....D...M.....V.....V....T....I.....T....G....R....D...D....VL...RK.E.HF.E.L..MRD.KT..II..A.N.....A...G..H...FQ..REI.N.....L..S.E.L.KDM....SQ..........G.I.NR.I.R.P......H......VT...A.........Y..........Q........I........E......G.......eD.............K....E........LFVLSD..ANLVNLSAG--dg.........................................................................
Q0UM97_PHANO/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAQ.ALH.SMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......F....Q.....V.....T.............T.............M.......E............K.........A............A...S...............Q........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.V.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KKN....AK..........S.V.SN.I.K.P......Q......VD...R.........Y..........L........M........P......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
Q07IV6_RHOP5/235-394             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............D.........A............A...P...............Q........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....I..A.H.L.KNL....--..........K.W.DN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............H....R........IILLSE..GRLVNLGNAMG...........................................................................
C0VJY4_9GAMM/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eS.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
Q0S2Y7_RHOSR/252-414             ..............................NKYGTRHSLL..DGI...N....R..G..T.D.V...L...IGG...K.....A.....AL.VC.G.Y.G.D.............VGKGCAE.ALR.GQG.A...R...V.A.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....E.....V.....K.............T.............V.......E............Q.........A............I...G...............W........A.....D...I.....V.....I....T....S.....T....G....N....K...D....II...TF.E.HM.K.Q..MKH.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS...gEV..........T.R.IN.I.K.P......Q......VD...E.........F..........R........F........K......D........G.............H....S........IIVLSE..GRLLNLGNATG...........................................................................
G3NYP4_GASAC/314-475             ..............................NLYCCRESIL..DGL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCT.ALK.ALG.A...I...V.C.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......S............E.........V............I...R...............Q........M.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.QL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RSP....EL..........T.W.ER.V.R.S......Q......VD...H.........I..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
D2BEM4_STRRD/233-395             ..............................NKYGCRHSVI..DGL...N....R..A..T.D.V...L...IGG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAD.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......D............E.........V............V...G...............I........A.....D...I.....F.....V....T....T.....T....G....N....F...D....II...TA.D.HM.A.R..MKH.NA..IV..S.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKI...pGI..........V.K.TE.I.K.P......Q......VH...T.........W..........A........F........P......D........G.............R....Q........ILVLAE..GRLMNLGCATG...........................................................................
SAHH_PYRAE/205-367               ..............................NRYGTGQSTW..DGV...M....R..A..T.N.L...L...IAG...K.....N.....VV.IA.G.Y.G.W.............VGRGIAI.RAR.GLG.A...R..rV.I.....V..V.....E...V..D.......P....I...R........A......L....E....A.........V...F....D......G.......Y....E.....V.....M.............P.............M.......D............K.........A............A...E...............V........G.....D...I.....F.....I....T....A.....T....G....N....I...R....AI...SL.G.HI.F.K..MKD.GA..VL..A.N.....A...G..H...FN..VEI.D.....V..A.G.L.ERV....AV..........A.K.RR.I.R.P......Y......LE...E.........Y..........T........L........P......N........G.............K....R........VYLIGE..GRLVNLVAAE-g..........................................................................
Q2C474_9GAMM/205-347             .........................sgflk----------..---...-....-..-..-.-.-...-...---...-.....-.....AG.VI.G.A.G.N.............LGRGVIK.HLK.AKGiT...N...I.H.....V..T.....D...I..D.......P....R...R........L......T....Q....F.........P...R....D......G.......I....Q.....A.....C.............S.............I.......K............Y.........L............V...E...............H........C.....N...M.....L.....F....C....C.....T....G....N....Q...S....I-...TP.E.MI.D.A..LSQ.PM..FI..S.T.....V...T..S...AD..DEL.H.....L..P.E.L.LQH...gVL..........T.E.VK.T.N.S......L......TK...E.........Y..........K........T........R......H........G.............Y....S........VYLFAG..GESAN------tpfktg.....................................................................
F0V187_9VIBR/171-332             ..............................NQYGVGQSVL..EAY...M....D..T..T.N.L...M...ING...K.....D.....VL.VV.G.Y.G.W.............CGKGIAK.YFS.LMG.A...K...V.T.....V..A.....E...T..S.......S....I...A........A......L....A....A.........F...M....E......G.......Y....T.....L.....S.............K.............V.......S............D.........A............I...I...............T........S.....D...V.....V.....V....T....A.....T....G....R....P...K....AL...SC.E.DM.K.L..AKT.GC..VF..M.N.....A...G..H...LR..EEL.P.....I..D.D.Y.VGQ....AL..........L.V.ET.L.T.P......G......IQ...K.........I..........H........L........D......A........E.............H....F........HYLLGR..GEMVNLTLG--kg.........................................................................
A5P6T9_9SPHN/230-389             ..............................NLYGCRESLV..DAI...R....R..A..T.D.V...M...LSG...K.....V.....AL.VA.G.F.G.D.............VGKGSAQ.SLR.NGG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............M.......E............E.........G............V...K...............R........A.....D...I.....F.....V....T....T.....T....G....N....E...D....VI...TA.E.HM.K.A..MKP.MA..IV..C.N.....I...G..H...FD..SEI.Q.....I..S.A.L.DNY....--..........E.W.TE.L.K.P......G......TD...L.........V..........K........F........P......D........G.............K....E........IIVLAK..GRLVNLACATG...........................................................................
E2PR18_9RHIZ/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
G4T616_PIRID/189-350             ..............................NYYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAE.SLR.SYG.A...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....E.....V.....T.............T.............M.......E............D.........A............A...P...............R........S.....N...I.....F.....V....T....T.....T....G....N....R...D....II...TG.A.HF.P.V..MPE.DA..IV..C.N.....I...G..H...FD..IEV.D.....V..A.W.L.KAN....AK..........S.V.TN.V.K.P......Q......VD...R.........F..........T........M........P......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
Q4RHJ7_TETNG/268-305             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------pcdls......................................................................
F4QY15_BREDI/224-383             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...LSG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.NGG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....Q.............T.............L.......E............D.........V............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...RV.E.HM.R.A..MRN.NA..IV..C.N.....I...G..H...FD..SEI.Q.....V..A.G.L.KNF....--..........K.W.DK.I.K.D......Q......VH...H.........V..........E........F........P......D........G.............K....K........IILLSE..GRLVNLGNATG...........................................................................
SAHH_JANMA/240-399               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.IA.G.Y.G.D.............VGKGSAQ.AMR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.E.HM.K.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.A.L.KQY....--..........T.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCGTG...........................................................................
H1JDM6_9FIRM/200-361             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...V...VAG...K.....T.....VC.VV.G.Y.G.W.............CGKGVAL.RAK.GLG.A...R...V.V.....I..C.....E...V..N.......P....I...K........A......N....E....A.........W...M....D......G.......F....E.....V.....M.............P.............M.......L............D.........A............A...P...............L........G.....D...F.....F.....V....T....V.....T....G....N....K...N....VI...SG.E.HF.L.V..MKD.GA..IL..S.N.....A...G..H...FD..VEV.N.....K..V.Q.L.AAM....AQ..........S.H.RE.V.R.R......N......IQ...E.........Y..........L........L........Q......D........G.............R....K........IYLLAE..GRLVNLAAG--dg.........................................................................
F4W8K2_ACREC/192-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.I...M...IAG...K.....V.....CV.VA.G.Y.G.D.............VGKGSAQ.SLG.ALG.G...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....E.....V.....T.............T.............M.......D............E.........A............S...T...............K........G.....Q...I.....Y.....V....T....T.....T....G....C....K...D....II...VD.R.HF.M.N..MPN.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..A.W.L.EKN....-A..........E.K.TN.I.K.P......Q......VD...R.........Y..........L........L........K......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
SAHH_BURM7/234-393               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
B9KRF4_RHOSK/231-390             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...Q...............D........A.....D...I.....F.....I....T....T.....T....G....N....R...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............S....R........IILLSE..GRLLNLGNATG...........................................................................
G2Q751_THIHA/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.F.G.D.............VGKGCAV.SLR.DMG.A...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....E.....V.....T.............T.............M.......E............K.........A............S...K...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.R.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..A.W.L.KAN....AQ..........S.V.QN.I.K.P......Q......VD...R.........Y..........L........L........K......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
E5C8J7_9BACE/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............E.........A............C...L...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...pGI..........K.C.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
H5SVQ4_9BACT/184-345             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.L...S...IAG...K.....T.....VV.VA.G.Y.G.W.............CGRGIAM.RAK.GLG.A...N...V.I.....V..T.....E...V..N.......P....V...R........A......I....E....A.........V...M....D......G.......F....R.....V.....M.............R.............M.......V............E.........A............A...P...............L........G.....D...I.....F.....V....T....A.....T....G....C....K...D....II...TE.E.SL.K.A..MKD.GA..IL..A.N.....A...G..H...FD..VEI.S.....K..P.D.L.EKL....SV..........S.R.RV.I.R.P......N......VE...E.........F..........E........L........Y......D........G.............R....R........LYLLAE..GRLVNLAAG--dg.........................................................................
B6R273_9RHOB/236-395             ..............................NRYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.SLS.GAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............T.............M.......E............Q.........A............I...G...............E........G.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...TA.D.HM.R.D..MKD.MA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNF....--..........K.W.RN.V.K.P......Q......VD...M.........I..........E........Y........P......D........G.............K....R........LILLSE..GRLVNLGNATG...........................................................................
G1LRB0_AILME/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....T...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........W........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
H3NUU4_9GAMM/199-375             ..............................NKYGCRHSLN..DAI...K....R..G..L.D.H...L...LAG...K.....R.....AL.VL.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...C..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....V.............Spf........lngV.......Ndgtd...asintD.........L............L...G...............Q........T.....D...L.....L.....C....S....A.....T....G....N....V...D....VC...NA.A.ML.R.A..LKP.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.REN....-W..........E.W.EE.V.K.P......Q......VH...K.........V..........Y........R........D......Rd......tN.............D....H........LLLLAE..GRLVNLGNATG...........................................................................
C6J396_9BACL/190-351             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...V...VAG...K.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.V.....V..T.....E...V..D.......A....I...K........A......V....E....A.........V...M....D......G.......F....Q.....V.....M.............P.............M.......L............E.........A............A...K...............I........G.....D...F.....F.....V....T....V.....T....G....N....R...D....VI...RG.E.HY.D.V..MKD.GA..IL..S.N.....A...G..H...FD..VEV.N.....K..P.E.L.AER....SV..........S.V.RT.V.R.K......N......IE...E.........Y..........Q........L........K......D........G.............R....K........MYLLAE..GRLVNLAAG--dg.........................................................................
D2PMF6_KRIFD/236-398             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............I.......E............D.........V............V...G...............T........A.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...TA.D.HM.A.Q..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.YKT...pGI..........E.R.VT.I.K.P......Q......VD...E.........F..........R........F........A......D........G.............H....T........VIILSE..GRLLNLGNATG...........................................................................
E1IG03_9CHLR/187-348             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....FV.VG.G.Y.G.Y.............CSRGIAE.RAR.GLG.A...N...V.I.....V..T.....E...I..D.......P....V...K........A......L....E....A.........T...M....D......G.......Y....R.....V.....M.............T.............M.......E............Q.........A............A...A...............Y........A.....D...F.....I.....V....T....A.....T....G....N....K...H....VI...DQ.R.AY.A.T..MKD.GC..VI..C.N.....S...G..H...FN..VEI.D.....I..P.A.L.EAM....SL..........E.K.RQ.P.R.T......F......ID...Q.........Y..........W........L........K......D........G.............R....K........INLLGE..GRLINLASAE-g..........................................................................
E2UQS3_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
A7TZB1_9MAXI/192-353             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AL.VA.G.Y.G.D.............VGKGSAQ.SLR.GFG.C...R...V.I.....I..T.....E...V..D.......P....I...N........A......L....Q....A.........A...C....E......G.......Y....E.....V.....T.............T.............M.......E............D.........A............V...S...............R........C.....N...I.....F.....V....T....T.....T....G....C....K...D....II...TA.E.HF.S.K..MKN.DA..IV..C.N.....I...G..H...FD..CEI.D.....I..G.W.L.ETS....CA..........A.K.VN.I.K.P......Q......VD...R.........Y..........T........M........S......N........G.............N....H........IIVLAE..GRLVNLGCAMG...........................................................................
A6UYP2_PSEA7/195-377             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSSQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Spy........kngI.......N............DgteasidaaL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgkdgfdA........H......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
G4PII5_BRUML/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
G2DER9_9GAMM/1-64                ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.-M.A.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.G.V.QKY....--..........E.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IIMLAE..GRLVNLGCATG...........................................................................
G0V1L6_TRYCI/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AC.VC.G.Y.G.D.............VGKGCAA.ALR.GFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....L.............L.............V.......E............D.........I............V...K...............D........A.....H...I.....F.....V....T....T.....T....G....N....D...D....II...TS.E.HF.P.H..MRD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..K.W.L.KEN....AK..........E.R.VE.V.K.P......Q......VD...R.........F..........T........M........P......N........G.............R....H........IILLAE..GRLVNLGCASG...........................................................................
H0P5K6_9SYNC/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....IV.VA.G.Y.G.W.............CGKGVAM.RAK.GMG.A...D...V.I.....V..T.....E...I..S.......P....V...P........A......I....E....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......A............E.........A............A...H...............Q........G.....D...I.....F.....I....T....V.....T....G....N....K...H....VI...RP.E.HF.A.V..MKD.GA..IV..C.N.....S...G..H...FD..IEI.D.....L..K.S.L.KEQ....AK..........E.V.KE.V.R.N......F......TE...Q.........Y..........I........L........P......N........G.............K....S........IIVIGE..GRLVNLAAAE-g..........................................................................
E9FR15_DAPPU/191-352             ..............................NLYGCRESLT..DGI...K....R..A..T.D.V...M...IAG...K.....T.....CV.VA.G.Y.G.D.............VGKGSAQ.SLR.AFG.A...R...V.L.....I..T.....E...V..D.......P....I...N........A......L....Q....A.........S...M....E......G.......Y....E.....V.....V.............T.............M.......D............E.........A............A...T...............K........A.....Q...I.....F.....V....T....A.....T....G....C....K...D....II...RP.Q.HF.N.A..MRD.DS..IV..C.N.....I...G..H...FD..CEI.D.....V..K.W.L.EAN....AV..........E.K.IT.I.K.P......Q......VD...R.........Y..........R........M........A......N........G.............N....H........IILLAE..GRLVNLGCAMG...........................................................................
H1XF44_9XANT/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KAL...kDV..........Q.K.IN.I.K.P......Q......VD...K.........Y..........V........F........P......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
G1MTN3_MELGA/250-411             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......S............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....D....R....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
H1CL04_9FIRM/183-344             ..............................NKYGTGQSVW..DAI...M....H..T..A.N.L...V...VAG...K.....T.....VV.VA.G.Y.G.W.............CGKGVAM.RAA.GMG.A...S...V.I.....V..T.....E...V..D.......P....F...K........A......L....D....A.........T...M....N......G.......F....R.....V.....M.............P.............M.......D............E.........A............A...R...............Y........G.....D...I.....F.....V....T....V.....T....G....C....K...D....VI...TP.K.HF.A.V..MKH.NA..IL..T.N.....A...G..H...FD..CEV.D.....V..A.G.L.AAM....AV..........K.R.EL.R.R.D......N......IE...G.........F..........T........L........P......D........G.............R....V........LNVIGE..GRLVNLAAG--ng.........................................................................
A5CPS8_CLAM3/252-414             ..............................NKYGIRHSLP..DGL...N....R..A..T.D.V...L...IGG...K.....V.....AF.VV.G.Y.G.D.............VGKGAAE.ALR.GQG.A...R...V.I.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............K.............L.......S............S.........V............I...E...............T........V.....D...I.....L.....V....T....G.....T....G....N....V...D....VV...RV.D.DI.Q.R..MKH.LS..VI..A.N.....V...G..H...FD..NEI.D.....M..A.G.L.ERL...pGV..........E.K.VE.I.K.P......Q......VH...E.........W..........R........L........P......N........G.............R....S........VLVLSE..GRLMNLGNATG...........................................................................
H8EAK3_CLOTM/184-345             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...I...VAG...K.....N.....VV.VV.G.Y.G.W.............CGKGIAM.RAK.GLG.A...S...V.I.....V..C.....E...V..D.......P....I...K........A......A....E....A.........V...M....D......G.......Y....K.....V.....M.............P.............M.......M............E.........A............A...K...............I........G.....D...L.....F.....I....T....A.....T....G....C....S...R....VI...HR.E.HF.K.V..MKD.GA..IL..C.N.....A...G..H...FD..VEV.S.....V..K.D.L.EEM....AV..........R.K.EE.Q.R.K......N......IM...G.........Y..........M........M........E......D........G.............R....W........INLLAE..GRLVNLAAG--dg.........................................................................
I0KGL9_9BACT/195-356             ..............................NKYGCRESLV..DAI...R....R..A..T.D.L...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAE.SLR.GAG.C...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....L.............P.............M.......D............E.........A............V...T...............R........A.....N...I.....F.....V....T....A.....T....G....N....I...G....II...KD.R.HF.R.A..MRD.KS..VV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NET...yGQ..........T.K.SQ.I.K.P......Q......VD...M.........Y..........E........V........-......D........G.............K....E........IIVLAE..GRLVNLGCAMG...........................................................................
A5Z4P4_9FIRM/110-242             .........................namlt-----AEGLI..SNI...I....N..N..T.P.F...A...LDT...A.....K.....AL.II.G.F.G.R.............CGINTAL.KLK.ALN.V...C...V.T.....I..Y.....D...H..T.......P....I...H........L......C....Q....A.........S...S....Y......G.......L....N.....T.....S.............T.............F.......D............N.........Li.........ecI...S...............D........F.....D...I.....I.....I....N....T.....V....P....C....-...E....VL...TE.N.LL.S.L..VKK.DC..VL..F.E.....V...A..S...KP..YGI.N.....N..E.L.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------vkkyrlslvtc................................................................
F6VIG9_HORSE/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.V.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...R...............E........G.....N...I.....F.....V....T....T.....T....G....C....V...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..Q...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........W........L........K......N........G.............R....R........IILLAE..GQLVNLGCAMG...........................................................................
E6SK69_THEM7/191-352             ..............................NRYGTGQSVW..DGI...M....R..L..T.N.L...V...VAG...K.....T.....VV.VC.G.Y.G.W.............CGKGVAE.RAR.GLG.A...R...V.I.....V..C.....E...V..D.......P....I...R........A......N....E....A.........L...M....D......G.......H....Q.....V.....M.............P.............S.......E............E.........A............A...A...............L........G.....D...V.....F.....V....T....V.....T....G....C....R...D....VL...VG.E.HF.R.R..MKD.GA..LL..A.N.....A...G..H...FD..VEI.S.....K..P.D.L.EAM....AQ..........R.V.EE.S.R.P......G......VR...T.........Y..........V........L........P......G........G.............R....R........LHLLAE..GRLVNLAG---gdg........................................................................
H2Z7I9_CIOSA/285-351             ..............................NLYSCRESVL..DGL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.E.............VGKGCCS.ALK.GLG.A...V...S.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------wwvlf......................................................................
C3R0P3_9BACE/236-398             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............E.........A............C...L...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...pGI..........K.C.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
D7IZI2_9BACE/236-398             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............E.........A............C...L...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...pGI..........K.C.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
Q0RR77_FRAAA/207-369             ..............................NRYGTGQSTL..DAI...F....R..A..T.N.T...L...LAG...R.....T.....VV.VA.G.Y.G.Y.............CGRGVAS.RAK.GLG.A...A...V.I.....V..T.....E...I..D.......P....T...K........A......L....D....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......G............A.........A............A...P...............L........G.....D...V.....F.....I....T....V.....T....G....N....R...D....VV...RR.E.HF.A.V..MRD.GA..IL..A.N.....S...G..H...FD..IEI.D.....I..V.A.L.AEL....AV..........E.VpRR.V.R.P......S......TD...E.........Y..........V........L........A......D........G.............R....R........LLLLAE..GRLVNLAAAE-g..........................................................................
G4QWS0_CORPS/237-399             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............T.............V.......D............Q.........A............I...S...............E........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.K..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.LlHRN....DV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............N....A........IIVLSE..GRLLNLGNATG...........................................................................
F9WIR5_TRYCI/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AC.VC.G.Y.G.D.............VGKGCAA.ALR.GFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....L.............L.............V.......E............D.........I............V...K...............D........A.....H...I.....F.....V....T....T.....T....G....N....D...D....II...TS.E.HF.P.H..MRD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..K.W.L.KEN....AK..........E.R.VE.V.K.P......Q......VD...R.........F..........T........M........P......N........G.............R....H........IILLAE..GRLVNLGCASG...........................................................................
F0JE79_DESDE/236-398             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VV.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......D............D.........A............A...P...............R........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VV...TG.A.HM.E.A..MKD.EA..IL..C.N.....I...G..H...FD..SEI.E.....M..I.Y.L.EKT...kGC..........T.K.KT.V.K.P......Q......VD...K.........W..........T........L........T......S........G.............R....S........IIILAE..GRLVNLGCATG...........................................................................
F6EZF2_SPHCR/230-389             ..............................NLYGCKESLV..DAI...R....R..A..T.D.V...M...LAG...K.....V.....AC.VA.G.F.G.D.............VGKGSAA.SLR.NGG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............E.........A............A...T...............R........A.....D...I.....F.....V....T....A.....T....G....N....E...A....VI...TV.D.HM.R.A..MKN.MA..IV..C.N.....I...G..H...FD..SEI.E.....I..A.G.L.NNM....--..........Q.W.TE.I.K.P......Q......VD...E.........V..........E........F........P......D........G.............K....K........IIVLAK..GRLVNLGCATG...........................................................................
F5LLX9_9BACL/136-263             ....................taegalmfai----------..---...-....Q..N..T.D.I...T...IHG...S.....Q.....SM.VL.G.F.G.R.............TGLTMAR.TLQ.GLG.A...K...V.K.....V..G.....V...R..K.......P....E...H........F......A....R....A.........L...E....M......G.......F....Tp..fyT.....R.............E.............L.......Y............Q.........E............V...A...............N........I.....D...L.....L.....F....N....-.....T....I....P....T...M....IV...TA.Q.II.T.N..IPH.RA..VL..I.D.....L...A..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------skpggmdfrfaekrgikaml.......................................................
A6QLP2_BOVIN/370-531             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IILLAE..GRLLNLSCST-v..........................................................................
C6X3N4_FLAB3/212-373             ..............................NKYGCRESAV..DAI...R....R..A..T.D.L...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFR.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............K.............L.......D............S.........V............V...A...............N........A.....D...I.....I.....I....T....T.....T....G....N....Y...N....IV...RG.E.HF.K.Q..MKD.KT..VV..C.N.....I...G..H...FD..NEL.D.....M..A.W.L.NEN...ySD..........T.K.YE.V.K.P......Q......VD...V.........Y..........N........I........-......D........G.............N....E........IIILAE..GRLVNLGCATG...........................................................................
SAHH_PYRKO/188-349               ..............................NRYGTGQSTW..DGI...I....R..T..T.N.L...L...VAG...K.....N.....VV.VV.G.Y.G.W.............CGRGIAM.RAR.GLG.A...T...V.I.....V..V.....E...V..D.......P....I...R........A......L....E....A.........R...M....D......G.......F....L.....V.....M.............D.............M.......M............E.........A............A...K...............V........G.....D...I.....F.....I....T....A.....T....G....D....I...N....CI...RK.E.HF.E.L..MKD.GA..IL..A.N.....A...G..H...FD..VEI.S.....K..P.D.L.EAL....AV..........E.I.SE.P.R.P......N......IT...E.........Y..........K........M........A......D........G.............R....R........LYLLAE..GRLVNLAAAD-g..........................................................................
F9DP61_9BACL/108-194             .......................rltaeaf---------V..QVF...Y....E..Q..T.K.R...Q...IAG...K.....H.....FY.VA.G.F.G.R.............VGKAVAQ.VLR.NLQ.A...T...V.T.....I..A.....A...R..S.......D....E...Q........L......A....E....A.........A...I....A......G.......Y....E.....P.....L.............R.............L.......T............E.........R............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------tvfsngylvntips.............................................................
Q221A0_RHOFD/241-405             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AL.IA.G.Y.G.D.............VGKGCAQ.AMR.ALS.A...Q...V.W.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........C.....D...I.....F.....V....T....C.....T....G....N....L...N....VI...TY.K.HM.A.A..MKD.QT..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.DKC....--..........K.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......Akg...ktpS.............K....R........IILLAK..GRLVNLGCGTG...........................................................................
F2K652_PSEBN/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spf........idgI.......N............Dgt.....eaS............V...Dka..........llgK........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........V..........H........RtgtgsfdpQ......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
F5T186_9GAMM/197-356             ..............................NLYGCRESLL..DGI...K....R..A..T.D.V...M...IAG...K.....I.....CV.VL.G.Y.G.D.............VGKGCAQ.AFR.GMG.A...T...V.F.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....R.....I.....V.............S.............M.......D............D.........V............A...A...............M........G.....D...I.....F.....V....T....T.....T....G....N....I...D....VI...NH.G.HM.L.K..MKN.EA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.L.RKY....--..........E.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
F1A3B7_DICPU/191-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALG.RQG.A...R...V.M.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........C...M....D......G.......Y....Q.....V.....V.............T.............M.......E............Y.........A............A...S...............Q........A.....N...I.....F.....V....T....T.....T....G....C....K...D....II...VG.K.HF.E.V..MKE.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..A.W.L.NAN....-A..........K.K.DN.V.K.P......Q......VD...R.........Y..........T........L........A......S........G.............T....H........IILLAE..GRLVNLGCGTG...........................................................................
E7Q2V9_YEASB/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAA.ALR.GMG.A...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............D.........A............S...H...............I........G.....Q...V.....F.....V....T....T.....T....G....C....R...D....II...NG.E.HF.I.N..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........E.C.IN.I.K.P......Q......VD...R.........Y..........L........L........S......S........G.............R....H........VILLAN..GRLVNLGCATG...........................................................................
G3SFV2_GORGO/186-346             ..............................NLYGC-EPLI..GGI...K....Q..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKSCAQ.ALR.DFR.A...S...V.I.....I..T.....K...T..D.......P....I...K........V......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............R...Q...............E........G.....D...V.....F.....V....T....T.....T....G....C....V...D....II...LG.Q.HF.E.Q..TKD.DT..IV..C.N.....T...G..Y...FD..VEM.D.....V..K.W.L.NKN....TV..........E.K.VN.V.K.L......Q......VD...P.........Y..........R........Q........K......N........G.............R....G........IILLAE..GRLVNLACAMG...........................................................................
E8R782_DESM0/184-346             ..............................NRYGTGQSTF..DGI...L....R..A..T.N.M...L...IAG...K.....V.....VV.VA.G.Y.G.W.............VGKGIAA.RAR.GLG.A...R..rV.I.....V..V.....E...V..N.......P....I...R........A......L....E....A.........V...Y....D......G.......F....E.....V.....M.............P.............M.......S............E.........A............A...E...............V........G.....D...I.....F.....I....T....A.....T....G....N....K...A....VV...RR.E.HF.E.K..MKN.GA..VL..A.N.....A...G..H...FN..VEV.W.....I..P.D.L.EAL....SR..........S.K.RQ.I.L.P......Y......VT...E.........Y..........E........L........S......D........G.............R....R........IYLLAE..GRLVNLVAAE-g..........................................................................
C5JTS9_AJEDS/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAQ.ALH.SMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......F....Q.....V.....T.............T.............M.......E............E.........A............A...P...............V........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.E.HF.S.V..MKN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........P......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
Q26HI6_FLABB/197-358             ..............................NKYGCRESAV..DAV...R....R..A..T.D.T...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFR.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........V...M....D......G.......F....E.....V.....K.............Q.............L.......E............N.........V............V...G...............N........A.....D...I.....V.....I....T....T.....T....G....N....K...D....II...RG.E.HF.K.S..MRD.KV..IV..C.N.....I...G..H...FD..NEI.D.....V..A.F.L.NEN...yGD..........T.K.VE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IILLAE..GRLVNLGCATG...........................................................................
SAHH_MYCTU/253-415               ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
#=GR SAHH_MYCTU/253-415    SS    ..............................HHHHHHHHHH..HHH...H....H..H..H.-.-...-...-TT...S.....E.....EE.EE.-.-.S.H.............HHHHHHH.HHH.HTT.-...E...E.E.....E..E.....-...S..-.......H....H...H........H......H....H....H.........H...H....T......T.......-....E.....E.....-.............-.............H.......H............H.........H............G...G...............G........-.....S...E.....E.....E....E....-.....S....S....S....S...-....SB...-H.H.HH.H.H..S-T.TE..EE..E.E.....-...S..S...SG..CCB.T.....H..H.H.H.HTT....TE..........E.E.EE.E.E.T......T......EE...E.........E..........E........E........T......T.......TT.............E....E........EEEEGG..GSBHHHHHS--...........................................................................
Q1HDX9_MUSAC/1-85                ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............----CAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....G......G.......L....P.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.K.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.G.L.E--....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
G7QA66_9DELT/234-396             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............A.........A............C...S...............Q........G.....D...I.....F.....V....T....A.....T....G....C....C...D....VV...TG.A.HM.E.K..MKD.GA..IV..C.N.....I...G..H...FD..SEI.A.....V..A.Y.L.ENT...pHC..........T.K.NQ.I.K.P......L......VD...K.........W..........T........M........A......S........G.............N....A........ILMLAE..GRLVNLGCATG...........................................................................
D9ZCK0_9CARY/1-123               ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.-LK.AGG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......F....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.G.L.ETY...pGI..........K.R.IT.I.K.P......Q......TD...R.........F..........V........F........P......D........T.............K....S.......gXIXLAE..GRLMNLGCATG...........................................................................
C9KKZ6_9FIRM/184-345             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.V...V...IAG...K.....N.....VV.IA.G.Y.G.W.............CGKGGAM.RAR.GLG.A...N...V.I.....V..T.....E...V..D.......P....I...K........A......I....E....A.........V...F....D......G.......F....R.....V.....M.............P.............M.......D............E.........A............A...K...............I........G.....D...I.....F.....L....T....L.....T....G....D....K...D....VI...RK.Q.HF.E.N..MKD.GA..IL..A.N.....S...G..H...FD..VEI.N.....I..P.E.L.ESL....SV..........S.R.RT.V.R.K......N......IE...E.........F..........K........Q........K......D........G.............R....K........IYLLAE..GRLVNLAAG--dg.........................................................................
G7QY38_MYCBO/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
F3L3H4_9GAMM/199-375             ..............................NKYGCRHSLS..DAV...K....R..A..T.D.H...L...LAG...K.....K.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....V.............Spf........vngV.......Ndgtd...acidrD.........I............M...G...............N........V.....D...L.....L.....V....T....A.....T....G....N....Y...N....VC...NA.A.ML.R.A..LKS.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RAK....-W..........E.W.EE.V.K.P......Q......VH...T.........V..........Y........R........D......Rd......sN.............D....H........LLLLSE..GRLVNLGNATG...........................................................................
SAHH_PETCR/240-403               ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.IA.G.Y.G.D.............VGKGCAA.AMK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............P.............L.......E............D.........V............V...S...............E........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.S.DM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tG.............R....G........IIILAE..GRLMNLGCATG...........................................................................
G2UTS5_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
D3NY11_AZOS1/193-352             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.SQG.A...R...V.M.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....I.............T.............M.......D............E.........A............A...P...............L........G.....D...I.....F.....V....T....A.....T....G....N....V...D....VI...TI.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..D.A.L.RNL....--..........V.W.EE.V.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLAQ..GRLVNLGCATG...........................................................................
F7WQL9_MYCTD/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
B4RBP7_PHEZH/224-383             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...LAG...K.....T.....AV.VM.G.Y.G.D.............VGKGSAA.SLR.NGG.A...R...V.M.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............V.......E............D.........V............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....K...D....VL...TV.D.HM.R.R..MKN.NA..IV..A.N.....I...G..H...FD..SEI.Q.....I..A.G.L.RNF....--..........K.W.DK.I.K.D......Q......VH...H.........V..........E........F........P......D........G.............K....K........IIVLSE..GRLVNLGNATG...........................................................................
D3SV14_NATMM/192-353             ..............................NVHGTGESSL..ASI...A....M..T..T.N.L...S...WAG...K.....T.....VV.VA.G.Y.G.Y.............CGKGVAK.KAA.GQN.A...N...V.V.....V..T.....E...V..E.......P....R...R........A......L....E....A.........H...M....E......G.......Y....E.....V.....M.............P.............M.......A............E.........A............A...E...............V........G.....D...V.....F.....L....T....T.....T....G....N....R...D....VI...VE.E.HF.E.K..MQD.GV..VL..A.N.....A...G..H...FD..IEI.D.....L..D.A.L.DDL....AA..........D.R.YE.A.R.D......G......VE...A.........Y..........E........M........D......D........G.............R....R........LNVIAE..GRLVNLAA---pvs........................................................................
SAHH_METPP/237-396               ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...IAG...K.....V.....AC.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....S....A.....T....G....N....K...N....VI...RY.E.HM.A.A..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EKL....--..........K.W.DE.I.K.P......Q......VD...H.........V..........V........F........P......D........G.............K....K........ITLLAK..GRLVNLGCATG...........................................................................
E6Q5G3_9ZZZZ/160-321             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.V...L...LAG...R.....T.....LV.VV.G.Y.G.W.............CGRGVAS.RAA.GMG.A...H...V.V.....V..T.....E...V..D.......P....R...K........A......I....E....A.........V...M....D......G.......Y....R.....V.....M.............P.............M.......T............E.........A............A...K...............I........G.....D...V.....F.....V....T....V.....T....G....N....Y...H....VI...SE.A.HF.K.L..MKD.GA..IV..C.N.....S...G..H...FN..DEL.D.....L..D.G.I.KKL....SK..........S.M.HV.P.R.T......F......VE...Q.........Y..........E........M........H......D........G.............R....K........VCILAD..GRLVNLAAG--eg.........................................................................
D7DA28_STAHD/185-347             ..............................NRYGTGQSTF..DGI...L....R..A..T.N.I...L...IAG...K.....V.....VV.VA.G.Y.G.W.............VGRGIAM.RAR.GLG.A..rR...V.I.....V..T.....E...V..D.......P....V...R........A......L....E....A.........V...F....D......G.......F....E.....V.....M.............P.............M.......I............E.........A............A...K...............V........G.....D...I.....F.....I....T....A.....T....G....D....K...A....VI...RK.E.HM.E.K..MKD.GA..IL..A.N.....A...G..H...FN..VEI.W.....I..P.D.L.ESL....SA..........G.K.RL.I.R.P......N......VT...E.........Y..........K........L........R......D........G.............R....R........IYLLAE..GRLVNLVAAE-g..........................................................................
A4WLG3_PYRAR/205-367             ..............................NRYGTGQSTW..DGV...M....R..A..T.N.L...L...IAG...K.....N.....VV.VA.G.Y.G.W.............VGRGIAI.RAR.GLG.A...R..rV.I.....V..V.....E...A..D.......P....I...R........A......L....E....A.........V...F....D......G.......F....E.....V.....M.............P.............M.......D............K.........A............T...E...............V........G.....D...I.....F.....I....T....A.....T....G....N....I...R....AI...NL.G.HI.F.K..MKD.GA..VL..A.N.....A...G..H...FN..VEI.D.....V..A.G.L.ERI....AV..........A.K.RR.I.R.P......Y......LE...E.........Y..........A........L........P......N........G.............R....R........VYLIGE..GRLVNLVAAE-g..........................................................................
E6UGZ2_RUMA7/112-239             ...........taegtlmtvmanttgtvyq----------..---...-....-..-..-.-.-...-...---...S.....R.....IL.VL.G.Y.G.R.............TGKSCAR.LFS.AAG.A...D...C.T.....V..A.....A...R..R.......P....E...I........L......A....Q....A.........W...S....D......G.......H....H.....T.....V.............H.............L.......S............D.........I............A...N...............S........A.....D...S.....F.....D....T....Ii...nT....V....P....A...V....VL...TE.E.IL.S.C..VQK.NC..LI..V.D.....L...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------asmpggtdffaaerlgikaih......................................................
E6V799_VARPE/239-398             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AC.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...TH.D.TM.V.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EKY....--..........E.W.EE.I.K.P......Q......VD...H.........I..........T........F........P......D........G.............K....K........IILLAK..GRLVNLGCGTG...........................................................................
C9VCS9_BRUNE/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
G8VZN8_KLEPN/177-326             .........................whtff----------..---...-....Q..T..T.H.L...T...LHE...K.....K.....VL.VI.G.Y.G.L.............VGQGVAA.AAK.AFG.G...Q...V.M.....V..A.....E...I..D.......P....A...R........R......L....Q....A.........A...Y....D......G.......W....H.....V.....V.............D.............L.......Q............E.........A............I...A...............S........A.....D...V.....V.....A....T....A.....T....G....G....K...N....VV...NR.Q.AL.D.R..AKA.GV..FI..L.N.....V...G..H...VA..EEI.D.....G..E.Y.L.RQY....--..........P.Q.EE.V.M.P......Y......IN...A.........Y..........R........M........A......D........-.............K....T........VYLLAN..GSMLNLTAG--fg.........................................................................
Q1AUI3_RUBXD/186-347             ..............................NRYGTGHSSI..ASI...V....S..N..T.N.L...F...LSG...K.....V.....VV.VM.G.F.G.W.............VGRGLAR.YAD.GMG.A...R...V.V.....V..C.....E...P..D.......P....V...K........L......I....E....A.........Y...A....E......G.......Y....E.....V.....M.............N.............S.......L............R.........A............A...E...............V........G.....D...V.....F.....V....T....G.....T....G....N....L...K....VL...RA.E.HF.E.R..MKD.GA..IL..A.N.....A...G..H...YD..HEF.D.....L..A.A.L.REM....AV..........A.E.RE.A.R.A......N......IT...E.........Y..........E........L........P......D........G.............R....R........LHVLAR..GRLVNIAAAD-g..........................................................................
F1S613_PIG/257-420               ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....T...S....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------rpplypvltkrqsgxlritishrnslsgaikihsrahlwdrdkrevlssepdwlqglgcvltlrgrllntapit.
G4M5A2_9BURK/235-394             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRN.NA..IV..C.N.....I...G..H...FD..SEI.D.....I..A.S.T.RQY....--..........T.W.DN.I.K.P......Q......VY...H.........I..........V........F........P......D........G.............K....K........IITLAE..GRLVNLGCATG...........................................................................
SAHH_BORBR/232-391               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.ALA.ALR.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....K.....V.....V.............T.............M.......E............E.........A............A...A...............H........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TR.Q.HM.E.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.G.L.ENC....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAK..GRLVNLGCATG...........................................................................
D2PC37_SULID/160-321             ..............................NRYGTGQSAI..DGI...L....R..A..T.N.I...L...IAG...K.....I.....TV.VA.G.Y.G.W.............VGRGIAN.RLR.GMG.A...R...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........V...M....D......G.......F....D.....V.....M.............P.............I.......A............E.........A............S...K...............V........G.....D...I.....F.....V....T....A.....T....G....N....T...K....AI...RV.E.HM.L.N..MKD.GA..IL..S.N.....A...G..H...FN..VEV.D.....V..K.G.L.KET....AV..........K.V.RN.I.R.P......Y......VD...E.........Y..........T........L........P......N........G.............K....K........VYLLAD..GRLVNLAAAE-g..........................................................................
G2I6W6_GLUXN/192-351             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............E.........A............A...P...............R........G.....D...I.....F.....V....T....A.....T....G....N....V...D....II...TL.D.HM.R.E..MKH.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..G.A.L.RNF....--..........K.W.DN.I.K.P......Q......VD...E.........V..........I........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
SAHH_PSEAE/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSSQ.SLR.QEG.M...I...V.K.....V..A.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Spy........kngI.......N............DgteasidaaL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgkdgfdA........H......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
E4NC13_KITSK/240-402             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............V...E...............S........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...LA.S.HM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKL...pGV..........V.K.TE.V.K.P......Q......VH...E.........W..........R........K........A......D........G.............K....T........IIVLSE..GRLLNLGNATG...........................................................................
H0C4L5_9BURK/237-397             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....R...D....VI...TF.E.HM.K.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.K.L.EEH....-C..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........A......D........G.............K....R........IILLAK..GRLVNLGCGTG...........................................................................
B6AQP5_9BACT/185-346             ..............................NRYGTGQSTL..DGI...M....R..A..T.N.R...L...FAG...S.....T.....VV.VA.G.Y.G.W.............CGRGIAR.RAQ.GLG.A...R...V.I.....V..T.....E...I..D.......P....V...K........A......L....E....A.........V...M....D......G.......F....H.....V.....M.............P.............M.......A............K.........A............A...P...............L........G.....D...F.....F.....I....T....V.....T....G....N....I...H....VV...GS.D.AF.D.V..MKD.GA..IV..C.N.....S...G..H...FN..VEI.N.....I..P.Y.L.ESI....SV..........S.K.SV.L.R.D......F......VE...E.........Y..........V........T........R......D........G.............R....K........IMVLGE..GRLINLAAAE-g..........................................................................
B1HA73_BURPE/234-393             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
D9U9W4_CAEFU/7-24                ..............................NLYCCRESIL..DGL...K....R..T..T.D.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
F6RAQ5_CALJA/268-429             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
F3KJK9_9ARCH/160-321             ..............................NRYGTGQSTI..DGY...L....R..A..M.N.L...L...MAS...K.....R.....VV.VV.G.Y.G.W.............VGRGVAA.RCH.GMG.S...K...V.I.....V..T.....E...I..D.......P....V...K........A......L....E....A.........H...M....D......G.......F....E.....V.....M.............P.............M.......S............Q.........A............C...K...............L........G.....D...I.....F.....I....T....C.....T....G....M....T...S....VI...RK.E.HI.L.Q..MKN.GA..IM..G.N.....V...G..H...FD..VEI.D.....S..K.F.L.LKE....SK..........S.V.KR.V.R.P......N......LD...E.........C..........T........L........K......N........G.............K....Y........VYLIGE..GRLANLVAAE-g..........................................................................
E8W4B2_STRFA/243-405             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............V...E...............T........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.S.DM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKI...dGV..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........A......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
F3M641_9BACL/190-351             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...V...VAG...K.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.I.....V..T.....E...I..D.......P....I...K........A......V....E....A.........Y...M....D......G.......F....H.....V.....M.............P.............M.......R............E.........A............A...K...............Q........G.....D...F.....F.....V....T....V.....T....G....N....R...D....VI...SG.E.DF.D.V..MKD.GA..IL..S.N.....A...G..H...FD..VEV.N.....K..P.D.L.SER....SQ..........S.V.RT.V.R.R......N......IE...E.........Y..........H........L........K......D........G.............R....K........IYLLAE..GRLVNLAAG--dg.........................................................................
E6N5I6_9ARCH/125-286             ...........................npl---GTGQSAL..DGV...L....R..A..T.N.L...L...LAG...K.....T.....VV.VA.G.Y.G.R.............VGAGIAE.RAK.GMG.A...R...V.V.....V..V.....E...P..D.......P....I...K........A......L....Q....A.........Y...M....N......G.......F....T.....V.....T.............S.............M.......S............K.........A............S...E...............I........G.....D...V.....F.....I....T....A.....T....G....N....I...D....VI...RG.E.HF.E.K..MKD.GV..FL..A.N.....A...G..H...MD..VEI.N.....K..Q.D.L.KQL....AV..........S.V.ET.I.R.E......N......VT...L.........Y..........R........L........R......N........G.............R....K........LFLLAD..GRLVNLVCAEG...........................................................................
A2D9T1_TRIVA/1-69                ..............................----------..---...-....-..-..-.-.-...M...IGG...K.....T.....AL.VI.G.Y.G.D.............VGKGCAQ.SLR.GQI.A...R...V.F.....I..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......D.......Y....Q.....V.....R.............R.............I.......E............E.........V............V...K...............D........V.....D...I.....F.....V....T....C.....T....G....N....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
C4R5W1_PICPG/190-351             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALR.GMG.A...R...V.I.....I..S.....E...I..D.......P....I...N........A......L....Q....A.........A...V....E......G.......Y....Q.....V.....A.............P.............L.......D............D.........V............V...S...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...TG.K.HF.E.Q..MPE.DA..IV..S.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AQ..........D.V.SN.I.K.P......Q......VD...R.........Y..........L........M........K......N........G.............R....H........VILLAD..GRLVNLGCATG...........................................................................
G4EBA3_9BACL/188-349             ..............................NRYGTGQSVF..DGI...N....R..T..T.N.L...V...VAG...K.....T.....VV.VS.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.V.....V..T.....E...V..D.......A....I...R........A......V....E....A.........Y...M....D......G.......F....A.....V.....M.............P.............M.......L............E.........A............A...K...............I........G.....D...I.....F.....I....T....V.....T....G....N....R...D....VI...RG.E.HY.A.V..MKD.GA..LL..A.N.....A...G..H...FD..VEV.N.....K..P.D.L.EEL....SV..........S.K.RT.V.R.K......N......IE...E.........F..........R........L........K......D........G.............R....R........LYLLAE..GRLVNLAAG--dg.........................................................................
F7I7D1_CALJA/254-415             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
B5DGE0_SALSA/192-353             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCVQ.ALR.GFG.A...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....E...D....IL...LG.K.HF.E.H..MKD.DS..IV..C.N.....I...G..H...FD..CEI.D.....M..N.W.L.NAN....AA..........E.K.IN.I.K.P......Q......VD...R.........Y..........R........M........K......S........G.............R....H........IIVLAE..GRLVNLGCAMG...........................................................................
B0SU34_LEPBP/199-361             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AL.VC.G.Y.G.D.............VGKGSAA.SLR.NFG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........V...M....E......G.......Y....Q.....V.....L.............R.............V.......E............D.........V............I...E...............N........A.....D...I.....I.....V....T....A.....T....G....N....D...D....II...SL.E.HM.K.A..MKD.GA..IL..C.N.....I...G..H...FD..TEI.Q.....M..A.R.L.NSE...kGV..........I.K.KE.I.K.P......Q......VD...K.........Y..........T........F........P......D........G.............K....S........IIVLAE..GRLVNLGCATG...........................................................................
F4RXA0_MELLP/189-350             ..............................NYYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAE.SLA.SYG.A...R...V.V.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....E.....V.....T.............T.............M.......E............E.........V............A...S...............R........A.....N...I.....F.....V....T....T.....T....G....C....R...D....II...VG.K.HF.E.A..MPE.DA..IV..C.N.....I...G..H...FD..IEV.D.....V..A.W.L.KQT....AK..........S.V.SN.I.K.P......Q......VD...R.........Y..........T........M........P......S........G.............R....H........IILLAE..GRLVNLGCAHG...........................................................................
F0QLL2_ACIBD/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
F3HD51_PSEYM/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidgendgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DS.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgagsfdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
I0A1B3_9CREN/185-346             ..............................NRYGTGQSTI..DGL...L....R..A..T.N.I...L...ISG...K.....T.....IV.VA.G.Y.G.W.............VGRGIAA.RAR.GMG.A...E...V.I.....I..T.....E...V..D.......P....V...K........A......L....E....A.........V...M....D......G.......Y....R.....V.....M.............K.............M.......E............E.........A............A...K...............I........G.....D...V.....F.....I....T....A.....T....G....D....K...D....VI...TW.K.HM.E.K..MKD.GA..IL..A.N.....S...G..H...FN..VEV.S.....V..K.D.L.EEN....SI..........S.S.RE.L.R.R......Y......MK...E.........Y..........K........M........K......N........G.............K....V........LYLLAE..GRLLNLVAAE-g..........................................................................
G4LX02_SCHMA/65-226              ..............................NLYGCRESLV..DGL...K....R..A..T.D.I...M...LAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCSQ.ALR.SYG.A...R...V.L.....I..T.....E...A..D.......P....I...N........A......L....Q....A.........V...M....E......G.......Y....E.....V.....T.............T.............M.......E............D.........G............A...K...............R........A.....K...I.....F.....V....T....A.....T....G....C....V...D....II...TG.E.HF.S.E..MMD.DA..IV..C.N.....I...G..H...FD..TEV.D.....V..K.W.L.NEN....CV..........S.I.ES.I.K.P......Q......VD...R.........Y..........T........L........K......N........G.............R....H........IILLAE..GRLVNLGCAHG...........................................................................
SAHH_SCHPO/192-353               ..............................NLFGCKESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCST.SLR.SQG.A...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....D......G.......F....E.....V.....T.............T.............M.......E............E.........A............V...K...............E........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...RG.E.HF.N.E..MKE.DS..IV..C.N.....I...G..H...FD..VEI.D.....V..A.W.L.KAN....AK..........D.V.VN.I.K.P......Q......VD...R.........Y..........E........L........K......N........G.............R....H........IILLAD..GRLVNLGCATG...........................................................................
F0NF41_SULIR/203-364             ..............................NRYGTGQSAI..DGI...L....R..A..T.N.I...L...IAG...K.....I.....TV.VA.G.Y.G.W.............VGRGIAN.RLR.GMG.A...R...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........V...M....D......G.......F....D.....V.....M.............P.............I.......A............E.........A............S...K...............V........G.....D...I.....F.....V....T....A.....T....G....N....T...K....AI...RV.E.HM.L.N..MKD.GA..IL..S.N.....A...G..H...FN..VEV.D.....V..K.G.L.KET....AV..........K.V.RN.I.R.P......Y......VD...E.........Y..........T........L........P......N........G.............K....K........VYLLAD..GRLVNLAAAE-g..........................................................................
H1CYV0_9FIRM/185-346             ..............................NRYGTGQSAW..DGI...I....R..S..T.N.L...T...VTG...K.....T.....VV.IA.G.Y.G.W.............CGKGVSM.RAK.GLG.A...H...V.I.....V..T.....E...V..D.......P....I...K........A......I....E....A.........V...M....D......G.......F....E.....V.....M.............P.............M.......D............E.........A............A...K...............L........G.....D...Y.....F.....L....T....V.....T....G....D....I...D....II...TE.R.HF.M.E..MKD.GA..IC..A.N.....A...G..H...FD..CEV.S.....R..K.D.L.ERI....CT..........R.K.FE.A.R.K......N......IE...G.........Y..........V........L........P......N........G.............K....T........VFLMAE..GRLVNLAAG--dg.........................................................................
F1W7Z6_MORCA/208-381             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LAG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............Spfing...epsqgV.......N...........tT.........L............L...Q...............D........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...NS.D.ML.T.A..LKS.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..N.F.M.RDN....-W..........R.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Dd......eR.............D....Y........LLVLSE..GRLVNLGNATG...........................................................................
D3ZQH8_RAT/189-331               ..............................NLYGCRESLV..DGI...K....Q..A..T.D.V...M...VSG...K.....V.....AA.LA.G.Y.G.D.............VG-GCAQ.ALR.GFG.A...R...V.I.....I..A.....E...T..-.......P....I...N........A......L....Q....T.........S...-....-......-.......-....K.....V.....T.............T.............M.......G............D.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....V...D....IV...FG.L.HF.E.Q..MKD.DA..IV..-.-.....-...-..-...--..---.-.....-..-.W.L.NEN....AV..........H.M.VN.I.K.S......Q......VG...H.........Y..........W........L........K......S........R.............H....C........IILLAE..GHLVNLP----fmms.......................................................................
A8LP94_DINSH/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......E............D.........T............V...K...............D........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............N....R........MILLSQ..GRLLNLGNATG...........................................................................
SAHH_LEPCP/237-396               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AC.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....R...D....VI...RH.E.HM.A.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EGY....--..........E.W.DE.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....K........IILLAK..GRLVNLGCATG...........................................................................
B4NJG0_DROWI/252-413             .............................t-FYTCRDSIL..DSL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.VC.G.Y.G.D.............VGKGCAQ.SLK.GQG.C...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....R.....V.....V.............R.............L.......S............E.........V............I...R...............N........V.....D...V.....V.....V....T....A.....T....G....N....K...N....VV...TR.D.HM.N.R..MKN.GC..VV..C.N.....M...G..H...SC..SEI.D.....V..S.S.L.HTP....EL..........V.W.ER.V.R.S......Q......VD...H.........I..........I........W........P......D........G.............K....M........IILLAE..GRLVNLSCST-i..........................................................................
H1Q975_9ACTO/243-405             ..............................NKYGCRHSLV..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......D............E.........V............V...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.K.DM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AQT...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........Y........P......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
C6X8F7_METSD/230-389             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TH.D.HM.Q.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EKY....--..........Q.W.DE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....K........IILLAK..GRLVNLGCGTG...........................................................................
B6WV15_9DELT/253-415             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VV.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............D.........A............L...A...............E........G.....D...I.....Y.....V....T....C.....T....G....N....L...R....VI...TG.E.HM.E.G..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.Y.L.EST...pGI..........T.K.LN.I.K.P......Q......VD...K.........W..........T........L........K......S........G.............R....S........IIVLAE..GRLVNLGCATG...........................................................................
C7Q1P5_CATAD/244-406             ..............................NKYGIRHSLP..DGL...N....R..A..T.D.V...M...LGG...K.....V.....AV.VC.G.Y.G.D.............VGKGAAE.ALR.GQG.A...R...V.V.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....D......G.......F....Q.....V.....A.............R.............L.......E............Q.........V............V...A...............D........G.....H...I.....F.....V....T....A.....T....G....G....T...G....AI...GV.E.HL.A.R..MRH.NA..IV..G.N.....V...G..H...FD..TEI.D.....L..A.G.L.AAH...pGV..........T.K.TE.I.K.P......Q......VH...Q.........W..........T........F........A......D........G.............H....A........VLVLSE..GRLFNLGNATG...........................................................................
C5FU41_ARTOC/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAE.ALR.SMG.A...A...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....A......G.......Y....Q.....V.....L.............T.............M.......E............E.........A............A...P...............K........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.E.HF.T.V..MKN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........Y..........L........M........P......S........G.............N....H........IILLAE..GRLVNLGCATG...........................................................................
E6RCY7_CRYGW/190-351             ..............................NYYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAE.SLR.SYG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....E.....V.....T.............T.............M.......E............E.........A............A...P...............R........G.....N...V.....F.....V....T....T.....T....G....C....R...D....II...TG.A.HF.E.A..MPE.DA..IV..S.N.....I...G..H...FD..VEI.D.....V..A.W.L.KAN....AV..........E.C.VN.I.K.P......Q......VD...R.........F..........T........M........K......S........G.............R....H........VILLAE..GRLVNLGCGTG...........................................................................
H0TU86_9BRAD/229-388             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....I.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..VV..C.N.....I...G..H...FD..NEI.Q.....V..A.S.L.KNL....--..........K.W.TN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............K....R........MILLSE..GRLVNLGNAMG...........................................................................
SAHH_RALME/231-390               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.V.EKY....--..........E.W.DE.I.K.P......Q......VD...H.........V..........K........F........P......D........G.............K....K........IIILAK..GRLVNLGCATG...........................................................................
F2N678_PSEU6/199-380             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spy........kngI.......N............DgteasvdaaL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.G.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RQN....-W..........G.W.EE.V.K.P......Q......VH...K.........I..........H........Rtgk.tvdpT......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
E0RHA2_PAEP6/190-351             ..............................NRYGTGQSAF..DGI...I....R..T..T.N.L...V...VAG...S.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.V.....V..T.....E...V..D.......P....I...K........A......V....E....A.........H...M....D......G.......F....H.....V.....L.............P.............M.......V............E.........A............A...K...............L........G.....D...F.....F.....I....T....V.....T....G....N....K...A....VI...TG.E.HF.D.V..MKD.GA..VL..C.N.....A...G..H...FD..VEV.S.....K..P.E.L.AKR....SE..........S.I.RT.V.R.R......N......IE...E.........Y..........R........F........K......D........G.............R....K........MYLLAE..GRLVNLAAAD-g..........................................................................
D0IYP5_COMT2/236-395             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AC.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...RH.E.HM.V.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EKY....--..........K.W.EE.V.K.P......Q......VD...Q.........I..........E........F........P......D........G.............K....K........ITLLAK..GRLVNLGCATG...........................................................................
E4PN47_MARAH/200-376             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...MAG...K.....K.....AL.VI.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....V..T.....E...A..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Spyid....gvntgT.......Esa.......vnrD.........L............L...Q...............N........T.....D...L.....L.....V....T....T.....T....G....N....M...N....VC...DA.H.ML.K.A..LKS.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RKN....-W..........E.W.DE.V.K.P......Q......VH...V.........V..........Y........R........D......Ka......tN.............D....H........LILLSE..GRLVNLGNATG...........................................................................
A1AX10_RUTMC/206-382             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.M...L...MSG...K.....K.....AL.II.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....I..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....I.....I.............Spying...inkgsI.......Dgi........nkD.........L............L...N...............T........T.....D...L.....I.....V....T....A.....T....G....N....I...N....VC...DN.A.ML.Q.T..LKP.GS..VV..C.N.....I...G..H...FD..NEI.D.....T..Q.Y.M.LDN....-W..........L.W.DE.V.K.P......Q......VH...R.........I..........F........R........T......D........N.............Ks..dY........LILLSE..GRLVNLGNATG...........................................................................
G0L3R1_ZOBGA/197-358             ..............................NKYGCRESAV..DAI...R....R..A..T.D.T...M...LAG...K.....K.....VV.VA.G.Y.G.D.............VGKGTAA.SFR.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....E.....V.....K.............K.............L.......E............T.........V............V...G...............K........A.....D...I.....V.....I....T....T.....T....G....N....K...D....II...RP.E.HF.K.A..MKD.KA..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NKN...yGN..........T.K.DE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IIVLAE..GRLVNLGCATG...........................................................................
D6B3H9_9ACTO/242-404             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............I...G...............Q........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.A.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AAI...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............K....V........IIVLSE..GRLLNLGNATG...........................................................................
SAHH_CHLTE/231-393               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VL.G.Y.G.D.............VGKGCAH.SMR.SYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........A............V...K...............E........G.....N...I.....F.....V....T....A.....T....G....N....K...D....VI...TL.D.HI.K.Q..MRD.EA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NNF...kGA..........T.R.IN.I.K.P......Q......VD...K.........Y..........V........F........E......N........G.............N....C........IYLLAE..GRLVNLGCATG...........................................................................
B4M6U8_DROVI/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....CC.VA.G.Y.G.D.............VGKGCAQ.ALK.GFG.G...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............S...K...............E........A.....S...I.....Y.....V....T....T.....T....G....C....R...D....II...TS.V.HL.L.N..MPD.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..D.W.L.NSN....AK..........E.K.VN.V.K.P......Q......VD...R.........Y..........T........M........P......N........G.............K....H........IILLAE..GRLVNLGCAHG...........................................................................
SAHH_NOSS1/192-353               ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....N.....VV.VV.G.Y.G.W.............CGKGTAL.RAR.GMG.A...N...V.I.....V..T.....E...I..D.......P....I...K........A......I....E....A.........V...M....D......G.......F....R.....V.....L.............P.............M.......A............E.........A............A...P...............Q........G.....D...I.....F.....I....T....V.....T....G....N....K...H....VV...RG.E.HF.D.V..MKD.GA..IV..C.N.....S...G..H...FD..LEL.D.....L..K.Y.L.AAN....AK..........E.I.KE.V.R.P......F......TE...E.........Y..........K........L........T......N........G.............K....S........VVVLGQ..GRLINLAAAE-g..........................................................................
D9VYW2_9ACTO/236-398             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............V...E...............I........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.S.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKI...eGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
F8E7L7_FLESM/228-390             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AV.IC.G.Y.G.D.............VGKGCAQ.ALR.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....E.....V.....K.............T.............L.......E............D.........T............L...G...............T........G.....D...I.....Y.....I....T....A.....T....G....N....R...D....VI...KA.G.HM.E.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..S.Q.L.NGI...pGI..........K.K.EN.I.K.P......Q......VD...K.........Y..........R........F........P......D........G.............H....E........IFMLAE..GRLVNLGCATG...........................................................................
SAHH_XANCP/238-400               ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........G.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NAL...kGV..........E.K.IN.I.K.P......Q......VD...K.........Y..........V........F........G......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
H6CKH6_9BACL/190-351             ..............................NRYGTGQSAF..DGI...I....R..T..T.N.L...V...VAG...S.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.V.....V..T.....E...V..D.......P....I...K........A......V....E....A.........H...M....D......G.......F....H.....V.....L.............P.............M.......V............E.........A............A...K...............L........G.....D...F.....F.....I....T....V.....T....G....N....K...A....VI...TG.E.HF.D.V..MKD.GA..VL..C.N.....A...G..H...FD..VEV.S.....K..P.E.L.AKR....SE..........S.I.RT.V.R.R......N......IE...E.........Y..........R........F........K......D........G.............R....K........MYLLAE..GRLVNLAAAD-g..........................................................................
H9JJV7_BOMMO/250-421             ..............................NLYSCRESII..DAL...K....R..S..T.D.L...M...FGG...K.....Q.....SV.VC.G.Y.G.E.............VGKGCCQ.ALK.ALG.C...V...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........Vlvshm..yagrvI...R...............Q........V.....D...I.....V.....I....T....A.....T....G....N....K...G....VV...TR.E.HM.E.R..MKN.GC..VV..C.N.....M...G..H...SN..TEI.D.....V..Y.A.L.KTP....DL..........L.W.ER.V.R.S......Q......VD...H.........I..........I........W........P......N........G.............K....R........IVLLAE..GRLANLCCSS-l..........................................................................
E6YNV7_9RHIZ/226-385             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...IAG...K.....I.....AI.IC.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.K.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....V.............T.............L.......E............D.........A............A...S...............S........A.....D...I.....I.....I....T....T.....T....G....N....K...D....VV...RL.E.HM.R.Q..VKD.MC..IL..G.N.....I...G..H...FD..NEI.Q.....V..S.A.L.KNL....--..........P.W.TN.I.K.P......Q......VD...M.........I..........T........F........P......D........G.............K....R........IILLSE..GRLLNLGNATG...........................................................................
Q4S7H8_TETNG/246-420             .............................s-LYCCKESVL..SGL...K....R..T..T.D.V...M...FGG...K.....Q.....VL.VC.G.Y.G.EvgeadqltsclaqVGKGCCA.ALK.AVG.A...V...V.Y.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............R.............M.......E............E.........V............A...A...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...VR.K.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....L..A.S.L.RTA....EL..........R.W.ER.V.R.S......H......VD...H.........V..........I........W........P......D........G.............K....R........ILLLAE..GRLLNLSCST-v..........................................................................
D3S0P2_FERPA/177-337             ..............................NRYGTGQSTW..DGI...L....R..A..T.N.I...L...VAG...K.....T.....VV.VA.G.Y.G.W.............CGRGIAL.RAK.GLG.A...R...V.I.....V..T.....E...V..D.......E....I...R........A......L....E....A.........L...M....D......G.......F....E.....V.....M.............P.............M.......S............E.........A............A...K...............I........G.....D...I.....F.....I....T....A.....T....G....N....I...D....VI...RR.E.HF.L.L..MKN.GA..IL..A.N.....A...G..H...FN..VEI.N.....I..E.E.L.EEL....AK..........N.V.RE.V.R.R......Y......VK...E.........Y..........D........L........G......N........-.............K....K........LYLLAE..GRLVNLVA---gdg........................................................................
E0VEP6_PEDHC/170-331             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...LAG...K.....V.....CV.VA.G.F.G.D.............VGKGCAA.SLR.AFG.G...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............A...K...............E........G.....Q...V.....F.....V....T....T.....T....G....C....K...D....VI...VG.R.HF.L.E..MKN.DS..IL..C.N.....I...G..H...FD..CEI.D.....V..N.W.L.EKN....SV..........E.K.MN.I.K.P......L......VD...R.........Y..........K........L........S......S........G.............R....N........VILLCE..GRLVNLGCAMG...........................................................................
H8X940_9ASCO/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAL.ALQ.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....A.............P.............M.......D............E.........V............A...S...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...VG.K.HF.E.K..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KEN....AQ..........S.V.VN.I.K.P......Q......VD...R.........Y..........L........M........K......N........G.............R....H........IILLAD..GRLVNLGCATG...........................................................................
G0V1L3_TRYCI/1-63                ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..MRD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..K.W.L.KEN....AK..........E.R.VE.V.K.P......Q......VD...R.........F..........T........M........P......N........G.............R....H........IILLAE..GRLVNLGCGTG...........................................................................
D1RKF0_LEGLO/202-361             ..............................NLYGCRESLL..DGL...K....R..A..T.D.V...M...VAG...K.....V.....AL.IL.G.Y.G.D.............VGKGCAQ.ALR.GQG.A...V...V.L.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............L.......D............D.........V............A...E...............Q........V.....D...I.....V.....V....T....A.....T....G....N....Y...H....VV...TH.E.HM.K.R..MRN.QA..IL..C.N.....I...G..H...FD..SEI.D.....V..Q.S.L.KKY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
B8G9P9_CHLAD/187-348             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....FV.VA.G.Y.G.W.............CSRGIAE.RAR.GLG.A...N...V.I.....V..T.....E...I..D.......P....V...K........A......L....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......V............E.........A............A...R...............Q........A.....D...F.....I.....V....T....A.....T....G....N....K...H....VI...DQ.N.AF.E.V..MKD.GC..VI..A.N.....S...G..H...FN..VEI.N.....I..P.A.L.ESL....SV..........E.K.RR.P.R.A......F......VD...Q.........Y..........I........L........R......D........G.............R....V........INLLGE..GRLVNLASAE-g..........................................................................
A7BAZ9_9ACTO/268-435             ......................naygtgqs----CWTTIL..DLI...D...pR..G..V.G.A...P...VAG...M.....S.....VV.VI.G.Y.G.D.............VGRGCAR.FGA.ALG.A...R...V.T.....V..V.....E...L..D.......P....V...R........A......L....Q....A.........S...M....D......G.......F....A.....V.....A.............S.............L.......Q............E.........A............A...A...............S........A.....G...M.....L.....I....S....A.....T....G....E....R...A....TI...PL.S.AL.E.A..APE.GA..IV..T.V.....A...G..G...VD..GEV.S.....I..D.E.A.VAA...sWV..........M.A.ES.G.D.P......H......VQ...T.........L..........T........S........P......S........G.............K....T........LRILER..GEGINYTA---geg........................................................................
I0GZA3_ACTMI/240-402             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VF.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............I.......D............E.........V............V...K...............Y........A.....D...I.....F.....V....T....A.....T....G....C....F...D....VI...TH.E.HM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AAR...kDV..........R.R.VT.I.K.P......Q......VD...E.........W..........Q........F........D......D........G.............H....S........IIVLSE..GRLLNLGNATG...........................................................................
E9BUB8_LEIDB/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....CC.VC.G.Y.G.D.............VGKGCAA.ALR.AFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........S...M....E......G.......Y....Q.....V.....A.............L.............V.......E............D.........V............M...A...............D........A.....H...I.....F.....V....T....T.....T....G....N....D...D....II...TS.E.HF.P.H..MRD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..G.W.L.EAN....AK..........E.H.VE.I.K.P......Q......VD...R.........Y..........T........M........E......N........G.............R....H........IILLAK..GRLVNLGCASG...........................................................................
I0G426_9BRAD/232-391             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....I..A.G.L.RNL....--..........K.W.TN.I.K.P......Q......VD...E.........I..........E........F........P......D........K.............H....R........IIMLSE..GRLVNLGNAMG...........................................................................
D1N9A3_9BACT/225-390             ..............................NIYGCRHSLT..DGI...K....R..A..L.D.V...M...LSG...K.....T.....VM.VC.G.Y.G.D.............VGKGCAE.ALH.NER.A...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........C...M....A......G.......F....Q.....V.....C.............T.............V.......E............D.........A............L...P...............Y........A.....D...L.....Y.....V....T....T.....T....G....N....C...R....II...TV.E.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..DEI.E.....V..A.K.L.EAY...pGI..........K.K.VE.I.K.G......Sf...cpVS...R.........F..........T........F........P......D........G.............H....S........IYLLAE..GRLVNLGCATG...........................................................................
B0MNU3_9FIRM/183-344             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...I...VAG...K.....N.....VV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...S...V.I.....V..T.....E...I..N.......P....I...K........A......M....E....A.........V...M....D......G.......F....K.....V.....M.............P.............M.......V............E.........A............A...K...............I........G.....D...F.....F.....V....T....V.....T....G....C....N...D....VI...GE.K.AF.L.N..MKD.GA..IL..S.N.....A...G..H...FD..VEV.N.....V..A.K.L.KEM....AV..........E.T.GV.A.R.N......N......IQ...Y.........Y..........K........L........A......N........G.............N....R........INVIAE..GRLVNLAAG--dg.........................................................................
G4G176_9GAMM/237-399             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAH.SLR.AYG.A...R...M.V.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....E.....V.....N.............T.............V.......E............S.........T............L...G...............R........G.....D...I.....Y.....V....T....T.....T....G....N....K...D....VL...TL.D.HL.K.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NAM...aGV..........S.K.LN.I.K.P......Q......VD...K.........Y..........T........F........K......D........G.............R....S........IFLLAE..GRLVNLGCATG...........................................................................
G5DYL0_9PIPI/178-317             ..............................NLYGCRE---..---...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.AFG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............S...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....M...D....IV...QG.R.HF.E.Q..MKD.DS..IV..C.N.....I...G..H...FD..P-V.G.....V..Y.F.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------lkkldeavaaahldklgvkltkltdkq................................................
F7Y1R7_MESOW/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSSA.SLK.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......E............D.........A............A...P...............T........A.....D...I.....V.....I....T....T.....T....G....N....K...D....VV...TL.D.HM.R.S..MKD.MV..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.RNL....--..........K.W.TN.V.K.P......Q......VD...M.........I..........T........F........P......D........G.............K....R........MILLSE..GRLLNLGNATG...........................................................................
F1XEP6_MORCA/208-381             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LAG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............Spfing...epsqgV.......N...........tT.........L............L...Q...............D........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...NS.D.ML.T.A..LKS.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..N.F.M.RDN....-W..........R.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Dd......eR.............D....Y........LLVLSE..GRLVNLGNATG...........................................................................
SAHH_METMP/183-343               ..............................NRYGTGQSAM..DGI...I....R..T..T.N.L...L...IAG...K.....N.....VV.VG.G.Y.G.W.............CGRGVAS.RAA.GHG.A...N...V.I.....I..T.....E...V..N.......P....I...R........A......L....E....A.........K...M....D......G.......F....T.....V.....L.............K.............M.......E............E.........A............A...K...............I........G.....D...I.....F.....V....T....T.....T....G....C....K...D....IL...RM.E.HF.L.L..MKD.GA..VL..S.N.....A...G..H...FD..NEI.N.....K..N.D.L.KEL....SK..........S.V.KE.A.R.F......N......IE...E.........Y..........D........L........G......N........-.............K....K........IYLLGE..GRLVNLACADG...........................................................................
B0E758_ENTDS/226-388             ..............................NIYGCRHSLI..DGI...N....R..A..T.D.V...M...IGG...K.....V.....AC.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.V.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....N......G.......Y....E.....V.....T.............T.............I.......E............N.........V............L...D...............R........A.....E...I.....Y.....V....T....T.....T....G....N....T...K....VI...LA.E.HM.A.H..MRN.NS..IV..C.N.....I...G..H...FD..NEI.D.....V..A.G.I.ESY...pGI..........I.R.EN.I.K.P......Q......VD...K.........F..........T........F........P......D........G.............H....S........ILLLAE..GRLVNLGCATG...........................................................................
D2MI68_9BACT/202-378             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....K.....AL.VV.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..A.....E...I..D.......P....I...C........G......M....Q....A.........C...M....D......G.......F....E.....V.....Vspynd...gintgK.............V.......E............D.........V............N...Kvl...........laN........T.....D...L.....I.....V....T....S.....T....G....N....Y...N....VC...DS.A.ML.Q.A..LKP.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RKH....-W..........E.W.EE.V.K.P......Q......VH...K.........V..........Y........R........S......Al......aN.............D....H........LILLSE..GRLVNLGNATG...........................................................................
F5LV58_GARVA/263-419             ........gtgetcvttmqqilgsecfkna----------..---...-....-..-..-.-.-...-...---...-.....K.....VT.VV.G.Y.G.P.............VGRGFAL.RIR.ALG.A...K...V.T.....I..C.....D...T..N.......P....V...Q........S......L....R....A.........V...F....D......G.......F....E.....A.....H.............N.............L.......E............C.........V............V...K...............K........S.....N...M.....I.....V....S....A.....T....G....V....R...H....TI...TL.Q.HM.Q.N..MQE.NA..IL..A.V.....I...G..G...IA..NEI.A.....L..D.E.I.PDF....--..........-.K.PF.V.G.T......S......QR...K.........I..........Q........V........P......C........G.............P....Q........ITLISE..GDGTN------yttggg.....................................................................
D9ZCI0_9CARY/1-123               ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.-LK.AGG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......F....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.G.L.ETY...pGI..........K.R.IT.I.K.P......Q......TD...R.........F..........V........F........P......D........T.............K....S.......gXIXLAE..GRLXNLGCATG...........................................................................
C8WRY5_ALIAD/188-349             ..............................NRYGTGQSVW..DGF...M....R..T..T.N.L...M...IAG...K.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAR.GLG.A...Q...V.V.....V..C.....E...V..D.......P....I...R........A......V....E....A.........V...M....E......G.......F....R.....V.....M.............P.............I.......R............E.........A............A...E...............I........G.....D...I.....F.....I....A....V.....T....G....N....K...A....VI...SR.D.AM.E.R..MKD.GA..IL..G.N.....A...G..H...FD..VEV.D.....K..A.A.L.ADL....AV..........E.V.RT.A.R.P......N......VD...E.........Y..........R........L........A......D........G.............R....R........LYLIAE..GRLVNLAAG--dg.........................................................................
B3NEZ6_DROER/280-441             ..............................NLYSCKESIL..DSL...K....R..S..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.D.............VGKGCAQ.ALK.GQG.C...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............N........V.....D...I.....V.....V....T....A.....T....G....N....K...N....VV...VR.E.HM.D.K..MKS.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..N.G.L.RTP....DL..........T.W.EK.V.R.S......Q......VD...H.........I..........I........W........P......E........G.............K....Y........IILLAE..GRLVNLSCSS-i..........................................................................
H5XTT5_9FIRM/186-347             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...V...VAG...K.....T.....AV.IA.G.Y.G.W.............CGKGVAL.RAK.GLG.A...R...V.I.....V..C.....E...I..N.......P....I...K........A......N....E....A.........L...M....D......G.......F....E.....V.....M.............P.............M.......V............E.........A............A...R...............F........G.....D...F.....F.....I....T....V.....T....G....N....M...D....II...NK.E.HF.V.L..MKS.GA..IM..C.N.....A...G..H...FD..VEV.N.....V..A.Q.L.KEI....SV..........S.E.RT.A.R.M......N......IT...E.........Y..........T........L........P......N........G.............H....Q........VYVLAE..GRLVNLAAG--dg.........................................................................
D9ZCK1_9CARY/1-123               ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.-LK.AGG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......F....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.G.L.ETY...pGI..........K.R.IT.I.K.P......Q......TD...R.........F..........V........F........P......D........T.............K....S.......gXIXLAE..GRLMNLGCATG...........................................................................
B1JTJ4_BURCC/233-392             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
SAHH_BORPA/232-391               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.ALA.ALR.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....K.....V.....V.............T.............M.......E............E.........A............A...A...............H........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TR.Q.HM.E.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.G.L.ENC....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAK..GRLVNLGCATG...........................................................................
SAHH_NICSY/240-403               ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............D........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
Q0FE41_9RHOB/224-383             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....T.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....T.............T.............L.......E............D.........T............I...S...............D........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.N.L.RNL....--..........K.M.TN.I.K.D......Q......VD...M.........Y..........E........M........P......S........G.............N....R........MILLSQ..GRLLNLGNATG...........................................................................
C7QMQ8_CYAP0/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.V...L...LAG...K.....V.....VV.VA.G.Y.G.W.............CGKGVAM.RAR.GLG.S...N...V.I.....V..T.....E...I..N.......P....V...R........A......I....E....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......A............E.........A............A...T...............Q........G.....D...I.....F.....V....T....V.....T....G....N....K...H....VI...RA.E.HF.E.V..MKD.GA..MV..C.N.....S...G..H...FD..IEI.D.....L..K.S.L.GAK....AS..........E.V.KE.V.R.N......F......TQ...K.........Y..........T........L........P......N........G.............K....S........IVVLGE..GRLINLAAAE-g..........................................................................
G6GEX9_9FIRM/188-349             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...V...VAG...K.....T.....VV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...R...V.I.....V..C.....E...V..D.......A....I...K........A......N....E....A.........W...M....D......G.......F....Q.....V.....M.............P.............M.......I............E.........A............A...T...............R........G.....D...F.....F.....V....T....V.....T....G....D....K...D....VI...RG.E.HF.E.V..MKN.GA..IL..A.N.....A...G..H...FD..VEV.N.....K..D.D.L.KAL....AS..........E.T.RI.V.R.P......N......IE...E.........F..........K........L........A......D........G.............R....K........LFLLAE..GRLVNLAAG--dg.........................................................................
SAHH2_DROME/252-413              .............................t-FYTCRDSIL..DSL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.D.............VGKGCAQ.SLK.GQG.C...I...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....R.....V.....V.............R.............L.......N............E.........V............I...R...............T........V.....D...V.....V.....V....T....A.....T....G....N....K...N....VI...TR.D.HM.N.R..MKN.GC..IL..C.N.....M...G..H...SC..SEI.D.....V..N.G.L.HTP....EL..........T.W.ER.V.R.S......Q......VD...H.........I..........R........W........P......D........G.............R....M........IILLAE..GRLVNLSCST-i..........................................................................
C8NLT6_COREF/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.VC.G.Y.G.D.............VGKGCAE.AFD.GQG.A...R...V.R.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......Y....S.....V.....V.............T.............V.......D............E.........A............I...A...............D........A.....D...I.....V.....I....T....A.....T....G....N....K...D....II...SY.E.QM.L.K..MKD.HA..LL..G.N.....I...G..H...FD..NEI.D.....M..H.S.L.LHR...dDV..........I.R.TT.I.K.P......Q......VD...E.........F..........T........F........P......N........G.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
H2YAU9_CIOSA/192-373             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AL.VA.G.Y.G.D.............VGKGSVQ.SLK.AFG.C...R...V.I.....I..S.....E...I..D.......P....I...N........A......L....Q....A.........A...M....G......R.......Y....E.....L.....T.............I.............I.......S............Q.........V............T...Dffr........tlrnQsy....fiA.....N...I.....I.....V....T....T.....T....G....C....K...D....II...TA.D.IF.Q.K..LPN.DC..IV..C.N.....I...G..H...FD..CEL.D.....V..A.W.L.NAN....AV..........E.K.IQ.V.K.P......Q......VM...TrlfvfrltdT..........Q........W........Q......V........A.............S....T........SILLAE..GRLVNLGCATG...........................................................................
B8I477_CLOCE/184-345             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...I...VAG...K.....N.....VV.VA.G.Y.G.W.............CGKGIAM.RAK.GFG.A...S...V.I.....V..T.....E...V..D.......P....I...K........A......A....E....A.........V...M....D......G.......F....K.....V.....M.............K.............M.......S............D.........A............A...K...............I........G.....D...Y.....F.....I....T....V.....T....G....C....R...D....VI...TA.E.HF.N.L..MKD.GV..IL..C.N.....A...G..H...FD..VEV.S.....V..E.E.L.EKI....AV..........E.K.QI.Q.R.N......N......IT...G.........Y..........K........M........E......N........G.............R....W........INLLAE..GRLVNLAAG--dg.........................................................................
SAHH_XANOP/238-400               ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.V.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KAL...kDV..........Q.K.IN.I.K.P......Q......VD...K.........Y..........V........F........P......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
E5X6A3_9ACTN/185-346             ..............................NHYGTGQSTL..DGI...V....R..A..T.N.R...L...LCG...R.....T.....IV.IS.G.Y.G.Y.............CGSGLAL.RAK.GMG.M...R...V.I.....V..C.....E...V..D.......P....L...K........A......L....E....A.........H...M....E......G.......Y....E.....V.....M.............P.............A.......A............E.........A............A...R...............F........A.....D...V.....W.....V....T....V.....T....G....N....C...K....VV...DG.P.AF.E.N..MKD.GA..IV..C.N.....S...G..H...FD..SEI.N.....L..E.W.L.EDH....AT..........K.K.EE.I.K.P......L......VE...E.........Y..........T........L........P......D........G.............R....T........VIVLAQ..GRLVNLSCAEG...........................................................................
D7E778_METEZ/227-389             ..............................NIYGCRESLV..DAI...K....R..G..T.D.V...M...VAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAE.ALA.NHK.A...R...V.I.....V..T.....E...S..D.......P....I...C........A......L....Q....A.........L...M....E......G.......Y....S.....V.....M.............T.............V.......E............D.........A............L...P...............Y........G.....D...I.....Y.....V....T....T.....T....G....N....R...D....VI...TT.D.HM.S.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.E.L.NKM...nNV..........E.K.VE.I.K.P......Q......VD...K.........Y..........E........F........P......D........G.............H....S........IYMLAE..GRLVNLGLATG...........................................................................
SAHH_PHASS/240-403               ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGLGCAA.ALK.TAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....P.....V.....L.............R.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ESF...pGV..........K.R.IT.I.K.P......Q......TD...R.........R..........V........F........P......D.......tN.............S....G........ILVLAE..GRLMNLGCATG...........................................................................
Q1PUP9_9BACT/203-379             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.I...L...LSG...K.....K.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.S.....I..S.....E...I..D.......P....I...C........G......M....Q....A.........C...M....D......G.......Y....E.....V.....V.............SpykdginngsaegI......nK............Q.........L............L...A...............K........T.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DR.H.ML.S.A..IKR.GA..VV..C.N.....I...G..H...FD..LEI.D.....T..K.F.M.REN....-W..........R.W.EE.V.K.P......Q......VH...Q.........I..........Y........R........S......Dd......pE.............D....Y........IILLSE..GRLVNLGNATG...........................................................................
SAHH_PROM9/233-392               ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...IAG...K.....V.....AL.VM.G.F.G.D.............VGKGSAQ.SLR.GLG.A...I...V.K.....V..A.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....S.....V.....V.............T.............L.......D............D.........V............V...E...............D........I.....D...I.....F.....V....T....A.....T....G....N....Y...Q....VI...TN.K.NL.V.K..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KDY....--..........P.W.EN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....K........IILLAE..GRLVNLGCATG...........................................................................
SAHH_BARQU/226-385               ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...IAG...K.....T.....AI.VC.G.Y.G.N.............VGKGSAA.SLS.GAG.A...R...V.K.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....V.............T.............L.......D............D.........A............A...S...............S........A.....D...I.....I.....I....T....T.....T....G....N....K...D....VV...RL.D.HM.R.Q..VKD.MC..IL..G.N.....I...G..H...FD..NEI.Q.....V..S.A.L.RNL....--..........P.W.TN.I.K.P......Q......VD...I.........V..........T........F........P......D........G.............K....R........IILLSE..GRLLNLGNATG...........................................................................
G2YBK9_BOTF4/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALH.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....M.............P.............M.......E............K.........A............A...S...............Q........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.E.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AA..........S.V.QN.I.K.P......Q......VD...R.........Y..........L........M........K......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
A0BCF6_PARTE/233-395             ..............................NIYGCRHSVI..DGI...F....R..A..T.D.V...M...LSG...K.....K.....AL.VC.G.Y.G.D.............VGKGCAQ.ALK.GQG.C...R...V.Y.....I..T.....E...V..D.......P....I...C........A......L....Q....G.........C...M....E......G.......Y....E.....V.....V.............R.............L.......E............K.........V............I...K...............D........I.....D...I.....F.....I....T....A.....T....G....N....K...D....II...TA.Q.HM.S.Q..MKH.NA..IV..G.N.....I...G..H...FD..NEI.D.....I..K.G.L.KQW...eGI..........K.R.VQ.I.K.P......Q......CD...Q.........W..........I........F........P......D........G.............H....G........IIMLAE..GRLLNLGCATG...........................................................................
SAHH_BURP1/234-393               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
#=GR SAHH_BURP1/234-393    SS    ..............................HHHHHHHHHH..HHH...H....H..H..H.-.-...-...-TT...-.....E.....EE.EE.-.-.S.H.............HHHHHHH.HHH.CTT.-...E...E.E.....E..E.....-...S..-.......H....H...H........H......H....H....H.........H...C....T......T.......-....E.....E.....-.............-.............H.......H............H.........H............T...T...............T........-.....S...E.....E.....E....E....-.....S....S....S....S...-....SB...-H.H.HH.H.H..S-T.TE..EE..E.E.....-...S..S...SC..GCB.-.....G..G.G.G.TTS....--..........E.E.EE.E.E.T......T......EE...E.........E..........E........-........T......T........S.............-....E........EEEEGG..GSBHHHHHS--...........................................................................
Q2S3G6_SALRD/189-350             ..............................NVYGTGQSTI..DGI...L....R..A..T.S.T...M...IAG...K.....N.....FV.IA.G.Y.G.H.............CGRGVAT.RAK.GMG.A...N...T.I.....V..T.....E...V..K.......P....A...K........A......L....K....A.........T...L....D......G.......H....Q.....V.....M.............S.............M.......D............E.........A............A...E...............K........G.....D...I.....F.....V....T....A.....T....G....M....K...D....VI...RG.R.HF.L.K..MKE.GA..IV..A.N.....T...G..H...YD..VEL.N.....L..E.E.L.AEL....ST..........D.A.RE.V.R.E......N......NR...E.........Y..........T........M........E......N........G.............K....R........VYVLGD..GRLVNLAAAE-g..........................................................................
A6LNV3_THEM4/171-331             ..............................NRYGTGQSTW..DSI...M....R..N..T.N.I...L...IAG...K.....N.....IV.VA.G.Y.G.W.............CGRGIAL.RAK.ALG.A...N...V.I.....I..T.....E...V..D.......P....I...K........A......L....E....A.........L...M....D......G.......Y....R.....V.....M.............K.............M.......S............E.........A............A...K...............I........A.....D...I.....I.....V....T....S.....T....G....M....K...D....VV...KF.E.DI.L.A..MKD.GI..IL..A.N.....A...G..H...FN..VEI.P.....V..K.E.I.EKH....AD..........K.I.FD.A.R.N......N......VK...G.........Y..........V........I........-......N........G.............K....K........VFVIGE..GRLVNLAAAD-g..........................................................................
Q4DNQ7_TRYCC/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AC.VC.G.Y.G.D.............VGKGCAA.ALR.AFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....L.............L.............V.......E............D.........I............V...E...............Q........A.....H...I.....F.....V....T....T.....T....G....N....D...D....II...TA.E.HF.P.R..MQD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..S.W.L.KAN....AK..........E.R.VE.V.K.P......Q......VD...R.........Y..........T........M........H......N........G.............R....H........IILLAE..GRLVNLGCASG...........................................................................
A5UL54_METS3/183-344             ..............................NRYGTGQSSF..DAI...M....G..T..T.N.M...L...IAG...K.....S.....VV.VC.G.Y.G.W.............CGRGIAL.RAQ.GLG.A...N...V.I.....V..T.....E...I..D.......P....I...R........A......L....E....A.........R...M....D......G.......Y....R.....V.....M.............K.............I.......R............D.........A............V...K...............E........A.....D...L.....I.....I....T....V.....T....G....N....I...N....II...HG.D.DF.K.Y..MKD.GC..ML..C.N.....S...G..H...FN..VEI.N.....R..R.D.L.EAQ....ST..........S.V.RE.V.R.E......S......IE...M.........F..........T........M........K......D........G.............R....K........IYLLAD..GRLVNLSAARG...........................................................................
A8PCR9_COPC7/189-350             ..............................NYYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAE.SLR.SYG.A...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....E.....V.....T.............T.............M.......E............D.........A............A...P...............R........A.....N...V.....F.....V....T....T.....T....G....N....R...D....II...TG.E.HF.S.V..MPE.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..A.W.L.KAN....AK..........A.V.VN.V.K.P......Q......VD...R.........F..........T........M........P......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
Q4SUC9_TETNG/198-358             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCVQ.ALR.GFG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....E...D....II...LG.H.HF.E.A..MKD.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..S.W.L.DKN....-A..........E.K.VN.I.K.P......Q......VD...R.........Y..........L........L........K......N........G.............R....H........IIILAE..GRLVNLGCAMG...........................................................................
F9QRR7_9MYCO/248-410             ..............................NKYGCRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGSAE.SVA.GQG.A...R...V.T.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....E......G.......F....D.....V.....K.............R.............V.......E............D.........V............I...G...............E........A.....D...I.....V.....I....T....T.....T....G....N....K...D....II...TL.E.HM.K.A..MKD.KA..IL..G.N.....I...G..H...FD..NEI.Q.....V..A.R.L.ERS....GA..........T.K.VN.I.R.P......Q......VD...L.........W..........T........F........P......D.......tG.............K....S........IILLSE..GRLLNLGNATG...........................................................................
E2SDU6_9ACTO/241-403             ..............................NKYGCRHSLI..DGL...N....R..A..T.D.V...M...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........V...M....D......G.......Y....E.....V.....K.............R.............L.......E............S.........V............I...D...............T........A.....D...I.....F.....I....T....T.....T....G....N....F...D....II...TV.D.HF.E.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.N.....M..A.G.L.ARI...pGI..........V.K.DE.I.K.P......Q......VH...Q.........W..........I........F........P......D........G.............K....K........IIVLSE..GRLLNLGNATG...........................................................................
A9UTL4_MONBE/191-352             ..............................NLYGCRESLL..DGI...K....R..A..T.D.V...M...IAG...K.....P.....AV.VA.G.Y.G.D.............VGKGCAQ.ALK.AFG.A...R...V.M.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...K...............E........A.....M...I.....F.....V....T....A.....T....G....C....K...D....IL...TA.K.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..CEI.N.....V..A.W.L.KAN....AK..........S.V.MN.I.K.P......Q......VD...R.........Y..........E........L........A......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
E1ARJ4_STRAU/236-398             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............V...E...............I........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.A.DM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKV...eGI..........V.K.DE.V.K.P......Q......VH...T.........W..........K........F........P......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
H2RWQ8_TAKRU/257-420             ..............................NLYCCKESVL..DGL...K....R..S..T.D.V...M...FGG...K.....Q.....VL.VC.G.Y.G.E.............VGKGCCA.ALK.AVG.A...V...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............M.......K............E.........V............V...R...............R........V.....D...M.....V.....I....T....C.....Tv..kG....N....K...N....VV...VR.K.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....L..A.S.L.RTA....EL..........R.W.ER.V.R.S......H......VD...H.........V..........I........W........P......D........G.............K....R........ILLLAE..GRLLNLTCST-v..........................................................................
G3IHR8_CRIGR/405-566             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
B6H9B6_PENCW/194-354             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALH.SMG.A...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...V....Q......G.......Y....E.....V.....N.............T.............M.......E............A.........A............A...P...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.R.HF.E.A..MRN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....SQ..........S.V.QN.I.K.P......Q......VD...R.........Y..........S........L........-......N........G.............K....N........IILLAE..GRLVNLGCATG...........................................................................
A3YW34_9SYNE/247-406             ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...VAG...K.....V.....AL.VM.G.Y.G.D.............VGKGSAQ.SLR.GLG.A...S...V.M.....I..A.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............R.............L.......D............D.........V............V...G...............D........V.....D...I.....F.....V....T....A.....T....G....N....F...R....VI...TH.D.HL.I.Q..MRD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KQY....--..........P.W.DN.I.K.P......Q......VD...H.........V..........L........L........P......S........G.............N....K........IILLAE..GRLVNLGCATG...........................................................................
H1RKE5_COMTE/236-395             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALS.ALR.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........C.....D...I.....F.....V....T....T.....T....G....N....K...D....II...RH.E.HM.V.A..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EKY....--..........E.W.EE.I.K.P......Q......VD...H.........I..........T........F........P......D........G.............K....K........IILLAK..GRLVNLGCATG...........................................................................
D2B5X0_STRRD/177-301             .............................n-VHGTGQSCV..MAA...L....D..L..T.G.L...Q...LAG...A.....V.....CV.VA.G.Y.G.Y.............VGQGVAR.YAR.ALG.A...R...V.V.....V..T.....E...V..E.......P....F...A........A......L....R....A.........H...H....E......G.......Y....E.....V.....R.............P.............L.......L............D.........A............C...P...............D........A.....D...L.....V.....F....S....A.....T....G....V....A...H....TV...TR.E.HL.R.A..MRP.GA..VV..A.V.....A...G..G...VP..DEV.E.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------agdvpagv...................................................................
C7Q1U7_CATAD/280-440             .......................eahwiae----------..-SV...V....R..A..I.R.E...L...LAG...E.....NfdgapAL.VV.G.Y.G.M.............VGEQVAQ.VLR.TQR.M...R...V.A.....V..H.....D...T..E.......W....R...K........L......V....A....A.........H...E....A......G.......F....L.....T.....A............pD.............L.......P............A.........L............L...Dg.............hR........P.....A...L.....I.....V....S....A.....T....G....R....T...G....-L...GG.E.DL.D.F..LPG.DC..FL..A.S.....V...S..A...RG..TEI.D.....M..P.G.L.AER....AE..........R.V.EE.V.A.H......V......GM...R.........Y..........V........L........P......N........G.............P....-........VTVLAD..GLSVN------gpr........................................................................
E4T730_PALPW/233-395             ..............................NLYGCRESLA..DGI...K....R..A..T.D.I...M...LAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCAR.SML.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....Q.....V.....T.............T.............I.......E............E.........A............L...A...............E........G.....N...I.....Y.....V....T....T.....T....G....N....R...D....II...RI.E.HI.E.K..MKD.AA..II..C.N.....I...G..H...FD..NEI.Q.....V..E.K.L.KQY...pGI..........E.C.VN.I.K.P......Q......VD...K.........Y..........I........F........P......D........G.............K....C........VLLLAD..GRLVNLGCATG...........................................................................
Q466R0_METBF/181-341             ..............................NRYGTGQSAW..DGI...N....R..T..T.N.L...L...VAG...K.....N.....VV.VA.G.Y.G.W.............CGRGVAM.RAS.GLG.A...N...V.I.....V..T.....E...V..D.......P....V...R........A......L....E....A.........R...M....D......G.......Y....R.....V.....M.............K.............M.......A............D.........A............A...K...............L........G.....E...I.....F.....V....T....T.....T....G....N....R...D....IL...TA.E.NF.K.S..MPD.GA..IL..A.N.....S...G..H...FN..VEI.D.....M..G.A.L.ESL....AK..........S.V.RT.V.R.H......N......IK...E.........Y..........D........L........G......D........-.............R....R........INVIAE..GRLVNLAAG--dg.........................................................................
H1XT89_9BACT/186-348             ..............................NRYGTGQSTV..DGI...I....R..A..T.D.F...L...VAG...K.....K.....VV.VA.G.Y.G.W.............CGKGFAM.RMK.GMG.A...N...V.I.....V..T.....E...V..H.......P....I...R........A......L....E....A.........A...M....D......G.......F....W.....V.....M.............P.............M.......S............E.........A............A...K...............I........G.....D...L.....F.....V....T....I.....T....G....D....I...H....VI...RK.E.HF.E.R..MKD.GA..IV..A.N.....S...G..H...FN..VEI.N.....I..D.D.L.EAL...aKE..........K.H.EN.V.R.N......N......VD...E.........Y..........V........L........Q......D........G.............R....R........IFLLAQ..GRLINLAAAE-g..........................................................................
B8KU67_9GAMM/199-375             ..............................NKYGCRHSLN..DAI...K....R..G..L.D.H...L...LSG...K.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....I..T.....E...A..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Spf........idgV.......N............D.........G............T...Dasvd......tqllgS........T.....D...L.....I.....V....T....S.....T....G....N....Y...D....VC...NA.A.ML.R.A..LKS.TA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.REH....-W..........E.W.EE.I.K.P......Q......VH...R.........I..........Y........R........D......Ra......qN.............D....Y........LLLLSE..GRLVNLGNATG...........................................................................
F1SQY7_PIG/156-313               ..............................NIYGCWESLI..DGI...K....Q..A..T.D.V...M...I--...K.....V.....VV.VM.G.Y.G.D.............VGKDYSQ.DLW.GFG.P...-...V.I.....I..I.....E...V..N.......P....I...K........A......F....Q....A.........A...T....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........S.....N...I.....F.....V....T....-.....T....G....C....T...D....II...LS.Q.HF.E.Q..MKD.DT..II..C.N.....V...G..Y...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........L........L........K......N........G.............H....R........IILLDE..GSRVNLGCSI-g..........................................................................
I1FL25_AMPQE/152-277             ...........................ttl---GTGDGLV..RAL...K....Q..S..G.Y.L...E...LQG...K.....E.....VL.LF.G.F.G.K.............VGRGITR.ALQ.LEG.L...H...V.S.....V..V.....E...LieK.......P....Q...K........Y......N....Q....S.........T...I....N......W.......I....S.....S.....Ns..........keR.............V.......L............S.........A............V...G...............D........A.....D...F.....I.....V....T....A.....T....G....V....N...G....VI...QN.N.YP.I.QpfLDS.KA..IL..I.N.....M...G..A...VD..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------eygsdf.....................................................................
SAHH_PSESM/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidgendgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DS.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgagafdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
F6GHJ0_LACS5/197-358             ..............................NKYGCKESAV..DAI...R....R..A..T.D.V...M...LAG...K.....R.....VT.VC.G.Y.G.D.............VGKGTAA.SFK.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............K.............L.......E............T.........V............V...G...............N........S.....D...I.....V.....I....T....T.....T....G....N....K...D....IV...RA.E.HF.K.A..MKD.KT..IV..C.N.....I...G..H...FD..NEI.Q.....M..A.W.L.NEN...yGN..........T.K.NT.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IIILAE..GRLVNLGCATG...........................................................................
C9UQ16_BRUAO/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
G3YZ70_9LACO/182-330             ........................adygtt----------..---...-....-..-..-.-.-...-...LLG...K.....K.....AL.VI.G.Y.G.K.............VGSSIAD.NLR.KRG.A...I...V.I.....V..A.....D...K..R.......A....I...R........L......A....N....A.........L...A....H......G.......Y....Q.....I.....T.............N............dI.......Y............T.........E............L...I...............D........I.....D...I.....V.....Y....I....A.....N....G....E....K...S....ID...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------alqlkkldlkhtlysfsvtsaddtfknsqiinelphyghnggyrilktksnktvilansgnainftysis.....
H2T1G2_TAKRU/358-519             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...VR.E.NL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
E6TPD5_MYCSR/244-406             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......Y....D.....V.....V.............T.............V.......E............Q.........A............I...G...............D........A.....D...I.....V.....I....T....S.....T....G....N....K...D....II...TL.D.HM.K.A..MKD.HS..IL..G.N.....I...G..H...FD..NEI.D.....I..A.A.L.ERS....GA..........T.R.IN.I.K.P......Q......VD...E.........W..........T........F........G......E.......tG.............K....S........IILLSE..GRLLNLGNATG...........................................................................
E9D3K1_COCPS/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.F.G.D.............VGKGCAQ.ALH.SMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....A......G.......Y....E.....V.....T.............T.............M.......E............E.........A............A...P...............L........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.S.HF.E.V..MKN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........P......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
B9NYW8_PROMR/233-392             ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...IAG...K.....V.....AL.VI.G.F.G.D.............VGKGSAQ.SLR.GLG.A...I...V.K.....V..A.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....S.....V.....V.............R.............L.......E............D.........V............V...E...............D........I.....D...I.....F.....V....T....A.....T....G....N....Y...Q....VI...TK.E.NL.V.K..MKN.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KNY....--..........P.W.EN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....K........IILLAE..GRLVNLGCATG...........................................................................
SAHH_RHOPA/230-389               ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...LSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............D.........A............A...P...............I........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.T.L.KNM....--..........K.W.DN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............K....R........MILLSE..GRLVNLGNAMG...........................................................................
G8PN05_PSEUV/236-395             ..............................NRYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.SLS.GAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............T.............M.......E............Q.........A............I...G...............E........G.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...TA.D.HM.R.D..MKD.MA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNF....--..........K.W.RN.V.K.P......Q......VD...M.........I..........E........Y........P......D........G.............K....R........LILLSE..GRLVNLGNATG...........................................................................
H2JQ72_STRHJ/243-405             ..............................NKYGCRHSLV..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............L.......D............E.........V............I...D...............K........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.S.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKV...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............K....K........IIVLSE..GRLLNLGNATG...........................................................................
B9K6V8_THENN/174-335             ..............................NRYGTGQSTW..DAI...M....R..N..T.N.L...L...IAG...K.....R.....VV.VA.G.Y.G.W.............CGRGIAL.RAS.GLG.A...K...V.I.....V..T.....E...V..D.......P....V...R........A......V....E....A.........I...M....D......G.......F....E.....V.....M.............P.............M.......K............E.........A............V...K...............L........A.....D...F.....V.....V....T....A.....T....G....N....T...D....VL...TE.E.DI.L.S..LKD.GA..VL..A.N.....A...G..H...FN..VEI.P.....V..E.T.L.ERL....AV..........E.K.FE.A.R.P......N......VT...G.........Y..........V........L........K......N........G.............K....T........VFLLAE..GRLVNLAAG--dg.........................................................................
D9ZCI5_9CARY/1-123               ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.-LK.AGG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......F....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.G.L.ETY...pGI..........K.R.IT.I.K.P......Q......TD...R.........F..........V........F........P......D........T.............K....S.......gXIXLAE..GRLMNLGCAXG...........................................................................
F6G656_RALS8/231-390             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.V.EKY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....K........IIILAK..GRLVNLGCATG...........................................................................
A3SKW8_9RHOB/227-386             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...D...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............A....R........IILLSE..GRLLNLGNATG...........................................................................
C7NPA1_HALUD/190-351             ..............................NVHGTGEASL..VSI...E....L..T..T.N.L...S...IAG...K.....T.....VV.VG.G.F.G.Q.............CGKGVAM.KAR.GMN.A...D...V.I.....V..T.....E...V..E.......P....R...Q........A......L....A....A.........H...M....E......G.......F....R.....V.....M.............P.............M.......V............E.........A............A...S...............E........G.....D...I.....F.....V....T....T.....T....G....N....R...D....VI...TR.D.AF.E.N..MQD.GA..VL..S.N.....A...G..H...FD..VEI.D.....L..E.T.L.EDM....AE..........N.T.FE.A.R.D......G......VR...G.........Y..........E........L........P......D........G.............R....Q........LNVLAE..GRLVNLAS---pva........................................................................
SAHH_METNO/229-388               ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....VI...TL.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.G.L.RNL....--..........K.W.TN.I.K.P......Q......VD...E.........I..........E........F........A......D........G.............H....R........IILLSE..GRLVNLGNAMG...........................................................................
F0XJF2_GROCL/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAL.ALH.GMG.A...R...V.L.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....A......G.......F....Q.....V.....T.............T.............M.......E............K.........A............A...P...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.K.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..A.W.L.KAN....AA..........S.H.TN.I.K.P......Q......VD...R.........F..........T........M........K......S........G.............R....N........LILLAE..GRLVNLGCATG...........................................................................
SAHH_AGRRK/227-386               ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....V.............L.............L.......E............D.........V............V...S...............S........A.....D...I.....F.....I....S....T.....T....G....N....K...D....VI...RI.D.HM.R.A..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........A......K........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
Q0VL82_ALCBS/198-374             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....K.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...A..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Sqy........kggI.......Ndgse...asintD.........L............L...G...............N........T.....D...L.....L.....V....T....T.....T....G....N....F...N....VC...DA.N.ML.K.A..IKK.GA..VV..C.N.....I...G..H...FD..NEV.D.....T..A.F.M.RET....-W..........E.W.EE.V.K.P......Q......VH...K.........V..........W........R........N......Ka......eG.............D....F........LLLLSE..GRLVNLGNATG...........................................................................
G2LEA4_CHLTF/193-355             ..............................NRYGTGQSTL..DGV...I....R..A..T.N.L...L...MAG...R.....T.....LV.VV.G.Y.G.W.............CGKGVAM.RGR.GLG.A...N...V.I.....V..C.....E...V..N.......P....I...R........A......I....E....A.........V...M....D......G.......F....R.....V.....M.............P.............I.......A............E.........A............A...T...............Q........G.....D...V.....F.....I....T....V.....T....G....N....R...H....VI...DR.Q.HF.A.V..MKD.GA..IV..C.N.....S...G..H...FD..LEL.N.....L..V.A.L.REM....AR..........E.V.RD.V.R.P......F......VQ...E.........Y..........E........L........A......E.......tG.............R....R........VIVLGE..GRLINLAAAE-g..........................................................................
H8GG32_METAL/190-349             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VC.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............L.......E............E.........A............A...P...............L........A.....N...I.....F.....V....T....A.....T....G....N....V...N....VI...TH.Q.HM.Q.A..MKN.QA..IV..C.N.....I...G..H...FD..SEI.D.....I..A.S.L.RRY....--..........T.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........LIVLAE..GRLVNLGCATG...........................................................................
F3LV30_9BURK/237-397             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............W.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....K...S....VI...TF.D.HM.A.K..MKH.NA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EAK....-C..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IIMLAK..GRLVNLGCATG...........................................................................
Q3U5U5_MOUSE/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....V...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.H......Q......VD...R.........Y..........W........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
E3S8A7_PYRTT/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAQ.ALH.SMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....T.............T.............M.......E............K.........A............A...P...............Q........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.A.HF.E.V..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KKN....AK..........S.V.TS.I.K.P......Q......VD...R.........F..........L........M........N......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
SAHH_DESVH/238-400               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............V...R...............T........G.....D...I.....F.....V....T....A.....T....G....N....C...N....VI...TG.A.HM.E.A..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.Y.L.ENT...eGC..........V.C.LN.I.K.P......Q......VD...K.........W..........T........L........R......S........G.............R....S........IIVLAE..GRLVNLGCATG...........................................................................
E2VYV9_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
Q3R6C1_XYLFA/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....L.....AV.VC.G.Y.G.D.............VGKGSAH.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....R.............T.............V.......E............D.........T............L...G...............Q........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.T.A..MKD.QV..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NTL...tGV..........Q.K.IN.I.K.P......Q......VD...K.........F..........I........L........P......N........G.............N....T........LFLLAE..GRLVNLGCATG...........................................................................
D6SPK6_9DELT/188-348             ..............................NYYGTGQSTV..DGI...L....R..A..T.N.V...L...LAG...K.....N.....FV.VA.G.Y.G.S.............CGKGVAK.RAQ.AMG.A...N...V.I.....V..T.....E...V..D.......Q....F...C........A......L....Q....A.........A...Y....D......G.......Y....K.....V.....M.............R.............M.......E............D.........A............A...K...............I........G.....D...I.....Y.....C....T....V.....T....G....N....K...H....VI...RM.E.HV.K.N..MKN.GS..IL..C.N.....S...G..H...FD..NEI.D.....I..P.A.L.EKG....AE..........S.K.RE.V.R.T......S......MD...E.........Y..........I........V........-......G........G.............K....K........IFVLGE..GRLVNLAAAE-g..........................................................................
A3M762_ACIBT/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
G7G9Z3_9GAMM/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...DS.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eS.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
F3F6Z1_9PSED/71-135              ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
SAHH_LEPBL/196-358               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AL.VC.G.F.G.D.............VGKGSAA.SLR.NFG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....Q.....V.....L.............R.............V.......E............D.........I............I...E...............Q........V.....D...I.....V.....V....T....A.....T....G....N....D...D....II...TL.E.HM.K.A..MKD.GA..IL..C.N.....I...G..H...FD..TEI.Q.....M..S.R.L.NSE...kGV..........T.K.KE.I.K.P......Q......VD...K.........Y..........T........F........P......D........G.............K....S........IVVLAE..GRLVNLGCATG...........................................................................
Q2L174_BORA1/232-392             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.ALS.ALR.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....K.....V.....V.............T.............M.......E............E.........A............A...A...............H........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TR.E.HM.N.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EKD....-C..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAK..GRLVNLGCATG...........................................................................
G8X537_FLACA/197-358             ..............................NKYGCKESAV..DAV...R....R..A..T.D.V...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFR.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....K.............K.............L.......D............T.........V............I...G...............N........A.....D...I.....V.....I....T....T.....T....G....N....K...D....IV...VS.R.HF.E.A..MKD.KT..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NAN...hGA..........T.K.QE.V.K.P......Q......VD...I.........Y..........N........V........-......N........G.............K....E........IIILAE..GRLVNLGCATG...........................................................................
G7W5X5_DESOD/186-347             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...V...VAG...K.....T.....AV.IA.G.Y.G.W.............CGKGVAL.RAK.GLG.A...R...V.I.....V..C.....E...V..N.......P....I...K........A......N....E....A.........L...M....D......G.......F....E.....V.....M.............P.............M.......V............E.........A............A...K...............H........G.....D...F.....F.....I....T....V.....T....G....N....T...N....II...NK.E.HF.V.V..MKP.GA..VM..C.N.....A...G..H...FD..VEV.N.....V..A.Q.L.KEI....AV..........S.E.RV.A.R.A......N......IM...E.........Y..........V........L........A......D........G.............R....Q........LYVLAE..GRLVNLAAG--dg.........................................................................
D0BXZ3_9GAMM/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
E1XXD6_LEGPN/202-361             ..............................NLYGCRESLL..DGL...K....R..A..T.D.V...M...IAG...K.....V.....AL.IL.G.Y.G.D.............VGKGCAQ.ALR.GQG.A...T...V.L.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............L.......D............D.........V............A...E...............Q........V.....D...I.....V.....V....T....A.....T....G....N....Y...H....VV...TH.D.HM.K.R..MRN.QA..IL..C.N.....I...G..H...FD..SEI.D.....I..Q.S.L.KQY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IIILAE..GRLVNLGCATG...........................................................................
F2CZE7_HORVD/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......I....Q.....I.....L.............T.............L.......E............D.........V............V...S...............D........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..N.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tN.............T....G........IIVLAE..GRLMNLGCATG...........................................................................
A6G922_9DELT/197-359             ..............................NLYGCRESLA..DGI...K....R..A..T.D.I...M...VAG...K.....T.....VV.VC.G.Y.G.D.............VGKGSAQ.SMR.GFG.A...R...V.L.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......D............E.........A............A...P...............V........G.....D...I.....F.....V....T....A.....T....G....C....A...D....VI...NF.E.HM.K.R..MKD.EA..IV..C.N.....I...G..H...FD..SEI.Q.....I..A.A.L.ENA...eDV..........T.E.IS.V.K.P......Q......VD...R.........F..........V........F........A......D........G.............H....A........IIVLAR..GRLVNLGCATG...........................................................................
E2U2U8_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
B2H8R8_BURPE/234-393             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
B9LQR3_HALLT/194-355             ..............................NVHGTGESSL..ATI...A....M..T..T.N.L...S...WAG...K.....N.....VV.VG.G.Y.G.Q.............CGKGVAM.KAS.GQN.A...N...V.I.....V..C.....E...V..D.......P....R...K........A......L....E....A.........H...M....E......G.......Y....E.....V.....L.............P.............M.......V............E.........A............A...K...............K........G.....D...V.....F.....I....T....T.....T....G....N....R...D....VI...TR.E.DF.E.E..MQD.GV..LL..A.N.....A...G..H...FD..VEV.N.....L..D.D.L.DDL....AV..........D.R.FE.A.R.D......G......VE...G.........F..........E........M........A......D........G.............R....V........LNVLAE..GRLVNLAA---pis........................................................................
H2PNH4_PONAB/370-531             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
H5URW0_9MICO/236-398             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............R.............L.......E............S.........V............V...E...............T........A.....D...I.....F.....I....T....T.....T....G....N....F...D....VI...RA.E.HM.R.A..MKN.KA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKT...pGI..........T.K.TE.I.K.P......Q......VH...E.........W..........T........F........E......N........G.............S....S........IIVLSE..GRLLNLGNATG...........................................................................
E3J0X6_FRASU/199-361             ..............................NRYGTGQSTL..DAI...F....R..A..T.N.T...L...LAG...K.....T.....VV.VA.G.Y.G.Y.............CGRGVAS.RSK.GMG.A...N...V.V.....V..T.....E...I..D.......P....T...K........A......L....D....A.........A...M....D......G.......F....R.....V.....L.............P.............M.......A............K.........A............A...A...............V........G.....D...V.....F.....I....T....V.....T....G....N....R...D....VI...RP.E.HV.E.L..MRD.GA..IL..A.N.....S...G..H...FD..VEI.D.....V..L.G.L.AAL....AV..........EgP.RR.V.R.P......S......TD...E.........Y..........V........L........A......D........G.............R....R........VLLLAE..GRLVNLGAAEG...........................................................................
D0MGJ5_RHOM4/189-350             ..............................NVYGTGQSTI..DGI...L....R..A..T.S.V...L...LAG...K.....N.....FV.VA.G.Y.G.H.............CGRGVAM.RAR.GMG.A...N...V.I.....V..T.....E...V..K.......P....T...A........A......L....K....A.........V...L....D......G.......F....R.....V.....M.............P.............M.......D............E.........A............A...E...............I........G.....D...I.....F.....V....T....A.....T....G....M....K...D....VI...RS.R.HF.R.K..MKD.GA..IV..C.N.....T...G..H...YD..VEL.N.....L..K.E.L.AEL....AV..........R.V.RE.V.R.P......N......NK...E.........Y..........L........L........E......N........G.............R....R........IYVLAD..GRLVNLAAAE-g..........................................................................
G6XKE5_9PROT/191-350             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............N.........A............A...P...............R........G.....D...I.....F.....V....T....C.....T....G....N....V...D....II...TI.D.HM.R.E..MKD.RA..IV..C.N.....I...G..H...FD..SEI.Q.....V..E.A.L.RNY....--..........R.W.NN.I.K.P......Q......VD...E.........I..........E........L........A......P........N.............H....R........IILLSE..GRLVNLGNATG...........................................................................
D9U9W3_RHYRA/7-24                ..............................NLYCCRESIL..DGL...K....R..T..T.D.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
D2ZNG9_METSM/183-344             ..............................NRYGTGQSSF..DAI...M....G..T..T.N.M...L...IAG...K.....S.....VV.VC.G.Y.G.W.............CGRGIAL.RAQ.GLG.A...N...V.I.....V..T.....E...I..D.......P....I...R........A......L....E....A.........R...M....D......G.......Y....R.....V.....M.............K.............I.......R............D.........A............V...K...............E........A.....D...L.....I.....I....T....V.....T....G....N....I...N....II...HG.D.DF.K.Y..MKD.GC..ML..C.N.....S...G..H...FN..VEI.N.....R..R.D.L.EAQ....ST..........S.V.RE.V.R.E......S......IE...M.........F..........T........M........K......D........G.............R....K........IYLLAD..GRLVNLSAARG...........................................................................
C7KYV3_ACEPA/189-348             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............E.........G............A...P...............R........G.....D...I.....F.....V....T....A.....T....G....N....V...D....VI...TL.D.HM.R.A..MKN.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..N.A.L.RNF....--..........T.W.DN.I.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
A4YIZ3_METS5/196-357             ..............................NRFGTGQSAI..DGV...L....R..A..T.N.I...L...IAG...K.....I.....CV.VA.G.Y.G.W.............VGRGIAS.RLR.GLG.G...R...V.I.....V..V.....E...A..N.......P....L...R........A......L....E....A.........V...M....E......G.......F....E.....V.....M.............T.............M.......K............E.........A............S...K...............I........G.....D...L.....F.....I....T....A.....T....G....N....I...R....AI...SK.E.HI.L.N..MKD.GA..IL..A.N.....A...G..H...FN..VEI.D.....V..D.G.L.RKM....AK..........S.R.RI.I.R.P......Y......TE...E.........N..........V........L........S......D........G.............R....R........IYLLAD..GRLVNLAAG--eg.........................................................................
E4XXS9_OIKDI/410-571             ..............................NLYSCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....S.....VS.VC.G.Y.G.E.............VGKGCAA.ALK.GMG.A...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....Q.............T.............I.......E............D.........I............A...D...............T........A.....D...V.....F.....I....T....C.....T....G....N....R...N....VI...TR.K.HM.D.K..MRN.GA..VV..A.N.....M...G..H...SN..TEI.E.....V..S.S.L.KTK....DL..........V.W.EK.V.R.S......Q......VD...H.........I..........I........W........Q......D........G.............K....R........IVLLAE..GRLLNYSCSS-v..........................................................................
A0LS32_ACIC1/234-396             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....L.....AV.VC.G.Y.G.D.............VGKGCAQ.ALR.GQG.A...R...V.V.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............L.......D............D.........V............V...T...............Q........A.....D...I.....V.....I....T....A.....T....G....C....V...N....VV...TV.D.HL.S.R..MKH.QA..IV..G.N.....I...G..H...FD..HEI.D.....M..A.G.L.AAV...pGI..........R.R.VP.I.K.P......Q......VD...E.........W..........V........F........P......D........G.............H....S........VIVLSE..GRLLNLGNATG...........................................................................
G9N875_HYPVG/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALH.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....Q.....V.....S.............T.............M.......E............K.........A............A...S...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TA.V.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........F..........T........M........A......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
C4FM76_9AQUI/185-346             ..............................NRYGTGQSTI..DGI...L....R..A..T.N.R...L...IAG...S.....K.....FV.VA.G.Y.G.W.............CGKGVAM.RAR.GMG.A...D...V.I.....V..T.....E...V..D.......P....L...K........A......L....E....A.........V...M....D......G.......Y....R.....V.....M.............P.............M.......E............E.........A............A...K...............I........G.....D...F.....F.....V....T....V.....T....G....N....I...N....VI...DK.H.HL.E.V..MKD.GA..IV..S.N.....S...G..H...FD..VEI.N.....L..K.A.L.EEM....AV..........A.T.RD.I.R.D......N......VK...E.........Y..........T........L........K......D........G.............R....N........IYILAE..GRLVNLAAAE-g..........................................................................
I0I3H7_9CHLR/192-353             ..............................NRYGTGQSTI..DGI...I....R..A..T.N.V...L...LAG...K.....N.....FV.VA.G.Y.G.W.............CSKGIAM.RAR.GMG.A...N...V.I.....V..T.....E...V..D.......P....L...K........A......L....E....A.........V...M....D......G.......Y....R.....V.....M.............P.............M.......L............E.........A............A...K...............I........G.....H...I.....F.....C....S....A.....T....G....D....I...N....VI...DG.H.HM.A.V..MQD.GA..IL..A.N.....S...G..H...FD..VEI.N.....L..K.A.L.RKM....SV..........K.I.TR.V.R.D......F......LD...E.........Y..........T........L........E......D........G.............R....R........LYVAGE..GRLVNLAAAE-g..........................................................................
G0HQF2_HALHT/168-329             ..............................NVHGTGESSL..ASI...A....M..T..T.N.L...S...WAG...K.....T.....VV.VS.G.Y.G.D.............CGKGVAK.KAS.GQN.A...D...V.I.....V..T.....E...V..E.......P....R...R........A......L....E....A.........H...M....E......G.......Y....D.....V.....K.............P.............M.......A............E.........A............A...A...............E........G.....D...V.....F.....I....T....T.....T....G....N....R...D....VI...VE.E.HF.E.A..MQD.GV..LL..A.N.....A...G..H...FD..VEV.D.....L..D.A.L.SDL....AA..........D.T.YE.A.R.D......G......VQ...T.........Y..........E........M........A......D........G.............R....R........LNVLAE..GRLVNLAT---pia........................................................................
D5RK63_9PROT/195-354             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.M.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............K........G.....D...I.....F.....V....T....A.....T....G....N....I...D....VI...TL.D.HM.R.A..MKH.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..G.A.L.RNF....--..........Q.W.DN.V.K.P......Q......VD...E.........V..........I........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
B1MF64_MYCA9/244-406             ..............................NKYGTRHSLV..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............Q.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....F...D....II...LL.E.HM.K.A..MKD.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.A.L.EKS....GA..........V.R.LN.I.K.P......Q......VD...L.........W..........T........F........G......D.......sG.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
D8PBK2_9BACT/185-346             ..............................NRYGTGQSTM..DGI...V....R..A..T.N.R...L...VCG...S.....T.....LV.VA.G.Y.G.W.............CGRGIAT.RAR.GMG.A...N...V.I.....V..T.....E...I..D.......P....L...K........G......L....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......D............E.........A............A...P...............L........G.....D...F.....F.....V....T....V.....T....G....N....L...K....VI...RG.E.HF.A.A..MKD.GA..IV..C.N.....S...G..H...FN..VEL.D.....I..P.A.L.EKL....SK..........K.K.LA.V.R.S......G......VD...Q.........Y..........T........L........K......N........G.............R....R........VSLLGE..GRLVNLATAE-g..........................................................................
H3A2V3_LATCH/276-437             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
D5BCE6_ZUNPS/192-353             ..............................NKFGCRESAV..DAI...R....R..A..T.D.V...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFK.GTG.A...I...I.T.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............R.............L.......E............T.........V............V...E...............K........A.....D...I.....V.....I....T....T.....T....G....N....K...D....IV...RG.E.HF.L.A..MKD.KT..IV..C.N.....I...G..H...FD..NEI.D.....V..A.W.L.NNN...yGE..........T.K.DE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IILLAE..GRLVNLGCATG...........................................................................
G3GZ56_CRIGR/159-320             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
D5GNP5_TUBMM/161-322             ..............................NLYGCRESLL..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AV.VA.G.Y.G.D.............VGKGCAD.ALR.SFG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....T.............T.............M.......E............E.........A............A...A...............Q........G.....Q...I.....F.....V....T....T.....T....G....C....T...D....IL...TA.K.HF.E.A..MKD.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..A.W.L.KAN....AV..........K.T.VS.I.K.P......Q......VD...R.........F..........H........M........K......S........G.............R....R........IILLAE..GRLVNLGCATG...........................................................................
D0RQF9_9PROT/189-348             ..............................NLYGCRESLV..DSI...R....R..A..T.D.V...M...MSG...K.....V.....AI.VA.G.F.G.D.............VGKGSAA.SLR.QAG.A...R...V.M.....V..T.....E...T..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....E.....V.....V.............L.............M.......D............E.........M............I...G...............N........A.....D...I.....V.....V....T....A.....T....G....N....K...D....IV...TA.D.HM.R.S..MKD.RS..IL..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KNY....--..........K.W.NE.I.K.P......Q......VH...E.........I..........E........F........P......D........K.............K....R........IILLAE..GRLVNLGCATG...........................................................................
SAHH_PROMM/237-396               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AL.VM.G.Y.G.D.............VGKGSAQ.SLR.GLG.A...T...V.M.....I..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............R.............L.......D............E.........V............V...Q...............D........V.....D...I.....F.....V....T....S.....T....G....N....F...Q....VI...RH.E.HL.I.R..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KDY....--..........P.W.EN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....K........IILLAE..GRLVNLGCATG...........................................................................
D0SAC1_ACIJO/197-372             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edv........naD.........L............L...Q...............N........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..N.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
D5H885_SALRM/189-350             ..............................NVYGTGQSTI..DGI...L....R..A..T.S.T...M...IAG...K.....N.....FV.IA.G.Y.G.H.............CGRGVAT.RAK.GMG.A...N...T.I.....V..T.....E...V..K.......P....A...K........A......L....K....A.........T...L....D......G.......H....Q.....V.....M.............S.............M.......D............E.........A............A...E...............K........G.....D...I.....F.....V....T....A.....T....G....M....K...D....VI...RG.R.HF.L.K..MKE.GA..IV..A.N.....T...G..H...YD..VEL.N.....L..E.E.L.AEL....ST..........D.A.RE.V.R.E......N......NR...E.........Y..........T........M........E......N........G.............K....R........VYVLGD..GRLVNLAAAE-g..........................................................................
F3HDA4_PSEYM/169-256             ............sdilptgyhgavtagvgp----------..---...-....-..-..-.-.-...-...--G...S.....T.....VY.VA.G.A.G.P.............VGLAAAA.SAR.LLG.A...A...VvI.....V..G.....D...V..N.......P....T...R........L......I....H....A.........K...A....Q......G.......F....E.....I.....A.............D.............L.......S............Q.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------dtplheqiaallgepev..........................................................
G7UPR6_PSEUP/239-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAH.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....N.............T.............V.......E............D.........S............L...G...............Q........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TL.A.HM.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..E.A.L.YAC....GA..........Q.R.IN.I.K.P......Q......VD...K.........F..........V........F........A......D........G.............H....A........IFLLAE..GRLVNLGCATG...........................................................................
F4JTV4_ARATH/195-358             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.IC.G.Y.G.D.............VGKGCAA.AMK.TAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tK.............A....G........IIVLAE..GRLMNLGCATG...........................................................................
D6Y6B6_THEBD/186-348             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.L...L...LAG...R.....V.....VV.VA.G.F.G.F.............CGRGVAD.RAR.GLG.A...R...V.I.....V..T.....E...V..D.......P....V...K........A......L....E....A.........A...L....Q......G.......Y....Q.....V.....E.............P.............M.......S............R.........A............A...E...............L........G.....D...V.....F.....I....T....V.....T....G....N....R...D....VI...RA.E.HF.A.V..MKD.GA..VL..A.N.....A...G..H...FD..VEI.D.....V..R.A.L.REL...aSA..........V.R.HG.V.R.P......N......TD...E.........Y..........V........L........P......D........G.............R....R........LLLLAE..GRVVNLTAAE-g..........................................................................
G3YG20_ASPNA/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAD.ALR.SMG.A...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....Q......G.......Y....Q.....V.....T.............T.............M.......E............E.........A............A...P...............Q........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.R.HF.E.V..MRN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........Y..........T........M........A......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
C6WJ47_ACTMD/248-410             ..............................NRYGIRHSLI..DGI...N....R..G..T.D.V...L...MGG...K.....V.....AV.IC.G.Y.G.D.............VGKGAAE.SLR.GQG.A...R...I.V.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........V...M....D......G.......Y....D.....V.....Q.............T.............L.......E............S.........V............L...P...............R........A.....D...I.....V.....I....T....T.....T....G....N....K...D....VV...RI.E.HM.A.A..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARF...pGV..........R.R.IN.I.K.P......Q......VD...E.........W..........V........F........P......D........G.............H....S........ILVLSE..GRLLNLGNATG...........................................................................
G3UGZ1_LOXAF/291-353             ricsvhnclhypgtplntktwglptcphhc----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.-S.A.H.L......Q......VD...R.........Y..........Q........L........K......N........G.............H....R........IILLAE..GRLVNLGCAMG...........................................................................
B0SIG6_LEPBA/199-361             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AL.VC.G.Y.G.D.............VGKGSAA.SLR.NFG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........V...M....E......G.......Y....Q.....V.....L.............R.............V.......E............D.........V............I...E...............N........A.....D...I.....I.....V....T....A.....T....G....N....D...D....II...SL.E.HM.K.A..MKD.GA..IL..C.N.....I...G..H...FD..TEI.Q.....M..A.R.L.NSE...kGV..........I.K.KE.I.K.P......Q......VD...K.........Y..........T........F........P......D........G.............K....S........IIVLAE..GRLVNLGCATG...........................................................................
H2HWM2_CORDP/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............H.............V.......D............Q.........A............I...G...............D........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.S..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHR...dDV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............K....S........IVVLSE..GRLLNLGNATG...........................................................................
D5Y8I0_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
Q2NFD5_METST/184-345             ..............................NRYGTGQSTF..DSI...M....G..T..T.N.S...V...IAG...Q.....T.....VV.VC.G.Y.G.W.............CGRGIAM.RAD.GLG.A...N...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........K...M....D......G.......Y....R.....V.....M.............T.............V.......Q............K.........A............L...E...............E........A.....D...I.....V.....I....T....A.....T....G....N....R...D....II...SG.D.DF.K.H..VKD.GC..ML..A.N.....S...G..H...FN..VEI.N.....E..N.D.L.ASQ....AI..........G.R.NM.L.K.P......D......IE...E.........F..........V........M........A......D........G.............R....S........IYLLAG..GRLVNLAG---qyg........................................................................
F6AFY4_PSEF1/194-376             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....V..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............SpyidgrndgtdacI.......D............K........aL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....A...N....VC...DA.G.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgagsfdA........A......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
A5GQ50_SYNR3/239-398             ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...VAG...K.....Q.....AL.VM.G.Y.G.D.............VGKGSAQ.SLR.GLG.A...T...V.C.....I..A.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....R.....V.....V.............R.............L.......D............D.........V............V...D...............Q........M.....D...I.....F.....V....T....A.....T....G....N....F...Q....VI...RH.E.HL.V.R..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KQY....--..........E.W.DN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....K........IILLAE..GRLVNLGCATG...........................................................................
D5SIX6_STRCL/300-459             ..............reiadsclrrlrtilp----------..---...-....-..-..-.D.R...K...LIG...R.....P.....IV.LL.G.Y.G.V.............LGSRLAA.QLR.ALG.C...R...L.T.....V..V.....D...T..D.......L....P...T........L......I....G....A.........A...E....D......G.......Y....T.....T....cR.............T.............L.......T............D.........A............Ll.aT...............T........P.....T...V.....I.....I....G....T.....T....G....E....Q...-....AL...TA.D.DI.P.L..LPD.QV..LL..A.P.....F...A..T...A-..---.D.....F..S.H.L.TEH...pRY..........S.R.TT.V.P.G......L......GV...R.........F..........T........L........P......G........P.............R....T........ITLLGD..GRSLNLYEA--ds.........................................................................
E4QPL4_METS6/230-389             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TH.D.HM.Q.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EKY....--..........Q.W.DE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....K........IILLAK..GRLVNLGCGTG...........................................................................
SAHH_RHOPS/230-389               ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.A...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............D.........A............A...P...............I........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....I..A.H.L.KNL....--..........K.W.DN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............K....R........MILLSE..GRLVNLGNATG...........................................................................
A4A9E5_9GAMM/199-375             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...LSG...K.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....V.............Spy........idgI.......Ddgsd...ecidrE.........L............L...Q...............K........T.....D...L.....L.....V....T....T.....T....G....N....Y...N....VC...NA.R.ML.G.A..LKS.AA..LV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RRE....-W..........Q.W.EE.I.K.P......Q......VH...K.........V..........Y........R........D......Qa......tN.............D....H........LILLAE..GRLVNLGNATG...........................................................................
F0Q1E6_ACIAP/176-325             .........................fsaea----------..--L...L....R..E..L.G.N...I...LTG...R.....R.....AL.VL.G.Y.G.K.............IGSSIAR.HLH.AKG.V...R...V.D.....V..Y.....D...T..N.......P....I...R........Q......V....L....A.........L...A....H......G.......Y....H.....T.....G.............P.............K.......H............E.........L............L...R...............S........S.....E...L.....V.....F....C....A.....T....G....N....R...S....IG...T-.S.DL.G.A..IRR.NA..YI..F.T.....A...T..S...AD..DEI.E.....N..H.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------qdmiasaspgghrhvlqvnaqgnrfflcnegksanfmhg....................................
A4AWF2_MARSH/197-358             ..............................NKYGCRESAV..DAI...R....R..A..T.D.T...M...LAG...K.....R.....VV.VA.G.Y.G.D.............VGKGTAA.SFK.GAG.A...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....E.....V.....K.............K.............L.......E............N.........V............V...G...............N........A.....D...V.....V.....I....T....T.....T....G....N....K...D....II...QA.K.HF.R.A..MRD.KV..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NEN...yGS..........T.K.DE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IIVLAE..GRLVNLGCATG...........................................................................
A3TQV3_9MICO/236-398             ..............................NKYGCRHSVI..DGL...N....R..A..T.D.V...L...IAG...K.....V.....AV.IC.G.Y.G.D.............VGKGCAE.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....A.............R.............L.......E............S.........V............I...D...............I........A.....D...I.....F.....V....T....T.....T....G....N....F...N....II...TA.E.HM.Q.Q..MKN.KA..IV..A.N.....I...G..H...FD..NEI.D.....I..A.G.L.AKV...pGV..........V.K.TE.I.K.P......Q......VH...E.........W..........T........F........S......G........G.............N....S........IIVLSE..GRLFNLGNATG...........................................................................
E0TE34_PARBH/225-384             ..............................NKYGCKESLV..DAI...R....R..G..T.D.V...M...MAG...K.....K.....AL.VA.G.Y.G.D.............VGKGSAQ.SLR.GAG.C...R...V.M.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............M.......A............D.........G............A...A...............Q........A.....D...I.....V.....V....T....A.....T....G....N....K...D....IV...TI.D.DM.R.R..MKD.MA..IV..C.N.....I...G..H...FD..NEI.Q.....V..E.A.T.RNW....--..........E.W.DN.I.K.P......Q......VD...M.........I..........T........K........P......D........G.............K....R........MILLSE..GRLVNLGNATG...........................................................................
H9UF27_9SPIO/255-417             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...TAG...K.....V.....AV.VC.G.F.G.D.............VGKGSAQ.SLR.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............T.............L.......E............E.........V............V...A...............Q........G.....D...I.....F.....V....T....C.....T....G....N....R...D....II...TI.E.HM.R.A..MKD.EA..IV..C.N.....I...G..H...FD..NEI.Q.....V..T.R.L.EQE...pGI..........S.H.IE.I.K.P......Q......VD...K.........Y..........V........F........A......D........G.............H....S........VILLAN..GRLVNLGCATG...........................................................................
H4FAB5_9RHIZ/226-385             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLQ.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......E............D.........V............V...S...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNL....--..........K.W.TN.V.K.P......Q......VD...M.........I..........E........F........P......K........G.............N....R........MILLSE..GRLLNLGNATG...........................................................................
A8PQ38_9COXI/198-357             ..............................NLYGCRESLI..DAL...K....R..A..T.D.V...M...IAG...K.....I.....AI.VC.G.Y.G.D.............VGKGCAQ.SLR.AYG.A...T...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........V...M....E......G.......Y....R.....V.....V.............T.............M.......D............E.........V............V...A...............L........G.....D...I.....F.....V....T....A.....T....G....N....K...D....VI...TL.N.HM.Q.Q..MKD.LA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.G.L.RQF....--..........N.W.LN.I.K.P......Q......VD...Q.........I..........N........F........P......D........Q.............K....R........LLLLAE..GRLVNLGCATG...........................................................................
B1FL08_9BURK/233-392             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
E4RJU1_HALSL/186-347             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...V...VAG...K.....T.....AV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...R...V.I.....V..T.....E...I..D.......P....I...K........A......S....E....A.........W...M....D......G.......F....E.....V.....M.............P.............M.......K............E.........A............A...K...............K........G.....D...F.....F.....I....T....V.....T....G....C....N...D....VI...AK.E.HI.K.E..MKD.GA..IL..S.N.....A...G..H...FD..VEV.S.....K..T.D.L.KEL....AV..........D.T.AE.A.R.K......N......IK...K.........Y..........E........M........A......D........Q.............R....K........IYLLAE..GRLVNLAAAD-g..........................................................................
SAHH_PSEF5/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidginhgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgpgdfdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
E1FVC1_LOALO/222-383             ..............................NLYGIRESLP..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VA.G.Y.G.D.............VGKGAAA.SLK.AFG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............T.............L.......E............H.........V............A...P...............V........A.....N...I.....V.....V....T....T.....T....G....C....K...C....VV...RG.E.HM.I.E..MPE.DA..IV..C.N.....I...G..H...FD..VEI.D.....I..N.W.L.NTN....AI..........S.R.DT.V.K.P......Q......VD...R.........Y..........L........L........K......N........G.............R....H........IIVLAE..GRLCNLGCATG...........................................................................
D7B5Q9_NOCDD/188-350             ..............................NRYGTGQSTI..DGI...L....R..A..T.N.A...L...LAG...R.....T.....VV.VA.G.F.G.Y.............CGRGLAE.RAR.GMG.A...R...V.V.....V..T.....E...V..D.......P....V...K........A......L....D....A.........V...M....Q......G.......Y....T.....V.....T.............T.............M.......E............E.........A............A...P...............A........G.....D...V.....F.....V....T....V.....T....G....N....R...D....VV...RA.E.HL.D.L..MKD.GA..IL..A.N.....S...G..H...FD..LEI.D.....L..N.A.L.ESR....AV..........E.V.NRgV.R.E......Q......AD...E.........Y..........V........L........A......D........G.............R....R........LLLLSE..GRLVNLGAAEG...........................................................................
SAHH_PSEPF/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spf........idgI.......N............Dgt.....eaS............I...Dka..........llgK........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........H........RtgagsfdpQ......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
F1VXK6_9BURK/240-399             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TH.E.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.A.L.KQY....--..........T.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......N........G.............K....R........IILLAE..GRLVNLGCGTG...........................................................................
SAHH_XANOM/238-400               ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.V.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KAL...kDV..........Q.K.IN.I.K.P......Q......VD...K.........Y..........V........F........P......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
E2BIK4_HARSA/192-353             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....CV.VA.G.Y.G.D.............VGKGCAQ.SLR.ALG.G...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...T...............K........G.....Q...I.....Y.....V....T....T.....T....G....C....K...D....II...GS.R.HF.V.N..MPN.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..T.W.L.QKN....AV..........E.K.MN.V.K.P......Q......VD...R.........F..........R........L........E......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
H2TA81_TAKRU/249-404             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........I............I...R...............Q........V.....D...V.....I.....I....T....C.....T....G....N....K...N....VV...TR.D.QL.D.R..MKN.GS..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............R....R........IILLAE..-----------vlhkq......................................................................
SAHH_METS4/229-388               ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.NAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....VI...TI.D.HM.R.S..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.G.L.KNL....--..........K.W.SN.I.K.P......Q......VD...E.........I..........E........F........P......D........G.............H....R........IILLSE..GRLVNLGNAMG...........................................................................
F1P3F1_CHICK/197-358             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.SFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....T...D....IV...QG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEV.D.....A..K.W.L.NQN....AV..........E.V.VN.V.K.P......Q......VD...R.........Y..........K........L........R......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
B1Y9X2_THENV/204-366             ..............................NRYGTGQSTW..DGV...L....R..A..T.N.L...L...IAG...K.....N.....VV.VA.G.Y.G.W.............VGRGIAM.RAR.GLG.A...R..rV.I.....V..V.....E...V..D.......P....V...R........A......L....E....A.........V...F....D......G.......F....E.....V.....M.............P.............M.......D............E.........A............A...K...............V........G.....D...I.....F.....I....T....A.....T....G....N....I...R....AI...NL.G.HI.F.K..MKD.GA..VL..A.N.....A...G..H...FN..VEI.D.....V..A.G.L.ERV....AV..........A.K.RQ.I.R.Q......Y......LE...E.........Y..........T........L........P......N........G.............R....R........VYLIGE..GRLVNLVAAE-g..........................................................................
F7N9W0_XYLFA/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....L.....AV.VC.G.Y.G.D.............VGKGSAH.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............V.......E............D.........T............L...G...............Q........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.T.A..MKD.QV..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NAL...tGV..........Q.K.IN.I.K.P......Q......VD...K.........F..........I........L........P......N........G.............N....T........LFLLAE..GRLVNLGCATG...........................................................................
A5ZYE9_9FIRM/161-208             .................hqavshlkeqgyd----------..---...-....-..-..-.-.-...-...MHG...K.....I.....CM.VI.G.N.G.E.............MGKVAAQ.TLR.DAG.A...N...V.T.....V..T.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------vrq........................................................................
SAHH_TRIVA/244-406               ..............................NIYGCRHSLI..DGI...N....R..A..S.D.V...M...IGG...K.....T.....AL.VM.G.Y.G.D.............VGKGCAQ.SLR.GQG.A...R...V.I.....I..T.....E...V..D.......P....I...C........A......L....Q....A.........V...M....E......G.......Y....Q.....V.....R.............R.............I.......E............E.........V............V...K...............D........V.....D...I.....F.....V....T....C.....T....G....N....C...D....II...SV.D.MM.A.Q..MKD.KA..IV..G.N.....I...G..H...FD..NEI.D.....T..D.G.L.MKY...pGI..........K.H.IP.I.K.P......E......YD...M.........W..........E........F........P......D........G.............H....A........ILLLAE..GRLLNLGCATG...........................................................................
C5A710_THEGJ/188-349             ..............................NRYGTGQSTW..DGI...I....R..T..T.N.L...L...VAG...K.....N.....VV.VV.G.Y.G.W.............CGRGIAM.RAC.GLG.A...T...V.I.....V..V.....E...V..D.......P....I...R........A......L....E....A.........R...M....D......G.......F....L.....V.....M.............D.............M.......K............E.........A............A...K...............V........G.....D...I.....F.....V....T....S.....T....G....N....I...K....CI...RR.E.HF.E.L..MKD.GV..IM..A.N.....A...G..H...FD..VEI.W.....K..P.D.L.EEL....AV..........E.I.SE.P.R.P......N......IR...E.........Y..........K........L........K......D........G.............R....R........LYLLAD..GRLVNLAAAD-g..........................................................................
C9T3C5_9RHIZ/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
A3X7G2_9RHOB/228-387             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............R.............L.......E............D.........V............V...D...............S........A.....D...V.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.N.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............N....R........LILLSE..GRLLNLGNATG...........................................................................
E1NTB9_9LACO/182-330             ........................adygtt----------..---...-....-..-..-.-.-...-...LLG...K.....K.....AL.VI.G.Y.G.K.............VGSSIAD.NLR.KRG.A...I...V.I.....V..A.....D...K..R.......A....I...R........L......A....N....A.........L...A....H......G.......Y....Q.....I.....T.............N............dI.......Y............T.........E............L...I...............D........V.....D...I.....V.....Y....I....A.....N....G....E....K...S....ID...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------alqlkkldlkhtlysfsvtsaddtfknsqiinelphyghnggyrilktksnktvilansgnainftysis.....
D5T6Q2_LEGP2/155-277             .............................t-VFGCAESSH..QAI...Q....K..L..T.G.V...D...PTN...K.....N.....WL.IF.G.F.G.K.............IGRGLAY.FCV.EH-.-...Q...V.P.....V..T.....V...V..D.......Ss.vhQ...C........D......L....A....S.........N...Lg..iE......S.......Ir.peE.....H.....D.............K.............L.......E............K.........A............V...A...............K........A.....D...I.....I.....L....T....A.....T....G....G....K...N....IM...S-.K.YP.R.A..WFD.GK..IL..G.N.....L...G..L...HD..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------efgpn......................................................................
G4R9F7_PELHB/227-386             ..............................NKYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AI.VC.G.Y.G.D.............VGKGSAE.SLR.GAG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....V.............T.............L.......E............D.........A............I...E...............R........A.....D...I.....V.....V....T....A.....T....G....N....K...D....VL...TI.D.HM.R.R..VKN.MA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...I.........V..........E........F........P......G........D.............K....K........MILLSE..GRLVNLGNATG...........................................................................
F5J2L6_9PORP/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAH.SMR.SYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............D.........A............V...K...............E........G.....N...I.....F.....V....T....T.....T....G....N....K...D....II...TI.E.HM.A.R..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.K.L.VNF...pNI..........K.H.IN.I.K.P......Q......VD...K.........Y..........V........F........P......D........G.............H....S........IFLLAE..GRLVNLGCATG...........................................................................
Q6ZMM9_HUMAN/153-312             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..TQ---------mdlqkig....................................................................
F1WMK0_MORCA/208-381             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LAG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............Spfing...epsqgV.......N...........tT.........L............L...Q...............D........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...NS.N.ML.T.A..LKS.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..N.F.M.RDN....-W..........R.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Dd......eR.............D....Y........LLVLSE..GRLVNLGNATG...........................................................................
G1SBL6_NOMLE/191-352             ..............................NLYGWQDSLI..DGI...K....R..A..P.D.V...M...IAG...K.....V.....VV.AA.G.Y.G.D.............VGNGCAQ.ALW.GFR.A...H...I.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...L.....F.....V....T....T.....T....G....C....V...D....II...FG.R.HF.E.Q..MKD.DA..IV..C.N.....T...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.V.VN.V.K.P......Q......VD...Q.........Y..........R........F........K......N........G.............H....R........VILLAE..GRLVNLGCATG...........................................................................
Q4Q124_LEIMA/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....CC.VC.G.Y.G.D.............VGKGCAA.ALR.AFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........S...M....E......G.......Y....Q.....V.....A.............L.............V.......E............D.........V............M...A...............D........A.....H...I.....F.....V....T....T.....T....G....N....D...D....II...TS.D.HF.P.H..MRD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..G.W.L.EAN....AK..........E.H.VE.I.K.P......Q......VD...R.........Y..........T........M........E......N........G.............R....H........IILLAK..GRLVNLGCASG...........................................................................
#=GR Q4Q124_LEIMA/190-351  SS    ..............................HHHHHHHHHH..HHH...H....H..H..H.-.-...-...-TT...-.....E.....EE.EE.-.-.S.H.............HHHHHHH.HHH.HTT.-...E...E.E.....E..E.....-...S..S.......H....H...H........H......H....H....H.........H...H....T......T.......-....E.....E.....-.............-.............H.......H............H.........H............T...T...............T........-.....S...E.....E.....E....E....-.....S....S....S....S...-....SB...-T.T.TG.G.G..--T.TE..EE..E.E.....-...S..S...SG..GGB.-.....H..H.H.H.HHH....-S..........E.E.EE.E.E.T......T......EE...E.........E..........E........-........T......T........S.............-....E........EEEEGG..GS-HHHHHS--...........................................................................
SAHH_LEPIC/196-358               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AL.VC.G.F.G.D.............VGKGSAA.SLR.NFG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....Q.....V.....L.............R.............V.......E............D.........I............I...E...............Q........V.....D...I.....V.....V....T....A.....T....G....N....D...D....II...TL.E.HM.K.A..MKD.GA..IL..C.N.....I...G..H...FD..TEI.Q.....M..S.R.L.NNE...kGV..........T.K.KE.I.K.P......Q......VD...K.........Y..........T........F........P......D........G.............K....S........IIVLAE..GRLVNLGCATG...........................................................................
G0CXA8_CORUB/237-399             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....S.....V.....V.............T.............V.......D............Q.........A............I...S...............E........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.D.HM.L.K..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.LlHRN....DV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............N....A........IIVLSE..GRLLNLGNATG...........................................................................
C6T8D6_SOYBN/1-23                ..............................----------..---...M....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGK----.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
D0KXU8_HALNC/198-382             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....V..T.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....V.............Sp...........yLnghndgsDtc.......vdkQ.........L............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.P.ML.K.A..LKN.GA..VV..S.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RKN....-W..........V.W.EE.I.K.P......Q......VH...K.........IyretapgsepN........L........D......S........D.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
B4PMV7_DROYA/252-413             .............................t-FYTCRDSIL..DSL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.D.............VGKGCAQ.SLK.GQG.C...I...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....R.....V.....V.............R.............L.......N............E.........V............I...R...............S........V.....D...V.....V.....V....T....A.....T....G....N....K...N....VI...TR.D.HM.N.R..MKN.GC..IL..C.N.....M...G..H...SC..SEI.D.....V..N.G.L.HTP....EL..........T.W.ER.V.R.S......Q......VD...H.........I..........R........W........P......D........G.............R....M........IILLAE..GRLVNLSCST-i..........................................................................
G2NC96_9ACTO/243-405             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............L.......D............D.........V............V...E...............T........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.G.DM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKI...dGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............R....V........LIVLSE..GRLLNLGNATG...........................................................................
C1EH64_MICSR/243-405             ..............................NLYGCRHSLP..DGI...M....R..A..T.D.V...M...IAS...K.....T.....CF.VA.G.F.G.D.............VGKGSAQ.ALK.AAG.A...R...V.I.....V..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....A.............P.............I.......E............D.........V............V...D...............I........C.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MV.H.HM.E.K..MKN.NA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ESF...pGI..........K.R.QN.I.K.P......Q......CD...R.........Y..........E........F........P......D........G.............H....G........VIMLAE..GRLLNLGCATG...........................................................................
G5DY95_9PIPI/1-88                .............................e----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HM.D.R..MKN.GC..IV..C.N.....-...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLSE..GRLLNLSC---...........................................................................
D2HBI3_AILME/284-445             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
Q9SP98_SOLCH/115-171             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.AMK.QAG.A...R...V.I.....V..T.....D...I..D.......P....I...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
Q3J6C7_RHOS4/224-383             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...Q...............D........A.....D...I.....F.....I....T....T.....T....G....N....R...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............S....R........IILLSE..GRLLNLGNATG...........................................................................
A1KYB0_TOBAC/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............D........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
B4IXV3_DROGR/282-443             ..............................NLYSCKESIL..DSL...K....R..S..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.D.............VGKGCAQ.ALK.GQG.C...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............N........V.....D...I.....V.....V....T....A.....T....G....N....K...N....VV...VR.E.HM.D.K..MKS.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..N.G.L.RTP....DL..........T.W.EK.V.R.S......Q......VD...H.........I..........I........W........P......E........G.............K....Y........IILLAE..GRLVNLSCSS-i..........................................................................
B4LBA6_DROVI/281-442             ..............................NLYSCKESIL..DSL...K....R..S..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.D.............VGKGCAQ.ALK.GQG.C...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............N........V.....D...I.....V.....V....T....A.....T....G....N....K...N....VV...VR.E.HM.D.K..MKS.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..N.G.L.RTP....DL..........T.W.EK.V.R.S......Q......VD...H.........I..........I........W........P......E........G.............K....Y........IILLAE..GRLVNLSCSS-i..........................................................................
Q0YP32_9CHLB/231-393             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VL.G.Y.G.D.............VGKGSAR.SMR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....A.............T.............M.......D............D.........A............V...G...............E........G.....N...I.....F.....V....T....T.....T....G....N....K...D....VI...TL.E.HM.K.R..MKD.EA..IV..C.N.....I...G..H...FD..NEI.Q.....V..E.Q.L.NTF...aGA..........K.R.LN.I.K.P......Q......VD...K.........Y..........T........F........A......N........G.............N....S........IYLLAE..GRLVNLGCATG...........................................................................
Q2PEU5_TRIPR/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....GV.VC.G.Y.G.D.............VGKGCAV.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......F....Q.....V.....L.............T.............L.......E............D.........V............V...S...............Y........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.DM.K.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..S.G.L.ENY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........L........F........P......E.......tN.............T....G........IIVLAE..GRLMNLGCATG...........................................................................
Q41974_ARATH/36-121              ..............................NLYGCGHSLP..XGL...M....R..A..T.D.V...M...VXG...X.....V.....XV.IC.G.Y.G.D.............VGXGCXA.AMK.TAG.X...R...V.I.....V..T.....E...I..D.......P....I...C........X......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............X........A.....D...I.....F.....V....T....T.....T....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
C3X5Q1_OXAFO/231-390             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VC.G.Y.G.D.............VGKGCAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...E...............Q........A.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.I.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.M.KQY....--..........T.W.EN.I.K.P......Q......VD...H.........I..........V........L........P......N........G.............N....R........IILLAE..GRLVNLGCGTG...........................................................................
Q069K5_9SOLA/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............D........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
F7A3T8_ORNAN/262-423             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
SAHH_SOLLC/240-403               ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.AMK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............F.............L.......E............D.........V............V...S...............E........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.G.L.ETF...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
E6VM93_RHOPX/230-389             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.A...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............D.........A............A...P...............I........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....I..A.H.L.KNL....--..........K.W.DN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............K....R........IVLLSE..GRLVNLGNATG...........................................................................
E5SW26_TRISP/187-348             ..............................NLYGIRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....L.....AC.VC.G.Y.G.D.............VGKGCAQ.ALK.GMG.A...R...V.M.....I..T.....E...I..D.......P....I...I........A......L....Q....A.........C...M....E......G.......Y....E.....V.....T.............T.............L.......E............E.........A............A...P...............R........C.....S...I.....F.....I....T....T.....T....G....C....C...D....VI...CG.Q.HM.L.K..MPE.DS..IV..C.N.....V...G..H...FD..VEI.D.....V..D.W.L.NKN....AV..........E.V.DN.I.K.P......Q......VD...R.........Y..........L........L........T......S........G.............R....H........IILLAQ..GRLANLGCATG...........................................................................
G4E8Z8_9GAMM/337-496             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VC.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...S...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............D.........A............A...A...............Q........A.....D...I.....F.....V....T....A.....T....G....N....V...N....VI...TR.E.HM.A.R..MKD.QA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.G.L.RQY....--..........P.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............H....R........IILLAE..GRLVNLGCGTG...........................................................................
C0ZWY9_RHOE4/250-412             ..............................NKYGTRHSLL..DGI...N....R..G..T.D.V...L...IGG...K.....A.....AL.VC.G.Y.G.D.............VGKGCAE.ALR.GQG.A...R...V.A.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....E.....V.....K.............T.............V.......E............Q.........A............I...G...............W........A.....D...I.....V.....I....T....S.....T....G....N....K...D....II...TF.E.HM.K.A..MKH.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.EKS...gDV..........T.R.IN.I.K.P......Q......VD...E.........F..........T........F........A......D........G.............H....S........IIVLSE..GRLLNLGNATG...........................................................................
E2CEJ5_9RHOB/223-382             ..............................NRYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....E.....V.....K.............T.............M.......E............Q.........A............L...P...............E........G.....D...I.....Y.....V....T....A.....T....G....N....K...D....II...TF.D.HM.R.G..MKD.MA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNT....--..........K.L.RP.V.K.D......Q......VD...M.........Y..........E........F........P......D........G.............K....R........MILLSQ..GRLVNLGNATG...........................................................................
SAHH_MYCSS/248-409               ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............Q.........A............I...G...............S........A.....D...I.....V.....I....T....S.....T....G....N....K...D....II...TL.D.HM.K.A..MKD.KA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.A.L.ERS....GA..........T.R.IN.I.K.P......Q......VD...E.........W..........T........F........D......D........G.............H....S........IVLLSE..GRLLNLGNATG...........................................................................
SAHH_RHILO/227-386               ..............................NKYGCKESLV..DGI...R....R..G..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSSA.SLK.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......E............D.........A............A...P...............T........A.....D...I.....V.....I....T....T.....T....G....N....K...D....VV...TL.D.HM.R.S..MKD.MV..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.RNL....--..........K.W.TN.V.K.P......Q......VD...M.........I..........T........F........P......D........G.............K....R........MILLSE..GRLLNLGNATG...........................................................................
H2M598_ORYLA/269-430             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...VR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
D9U9W9_SMICR/7-24                ..............................NLYCCRESIL..DGL...K....R..T..T.D.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
B6B5W2_9RHOB/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............L.............L.......E............D.........V............V...S...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.RNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
A6WER2_KINRD/240-407             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....T.....AV.VF.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.V.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....V.............R.............L.......E............D.........V............V...E...............T........A.....D...I.....F.....I....T....A.....T....G....N....K...D....VI...MA.A.DI.A.K..MKH.QA..LV..G.N.....I...G..H...FD..NEI.D.....I..A.G.L.ARI...pGV..........E.K.VE.I.K.P......Q......VH...E.........W..........R........I........P......Aae...grpA.............H....N........VIVLSE..GRLLNLGNATG...........................................................................
E3F164_KETVY/225-384             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......E............D.........V............V...E...............T........A.....D...I.....F.....I....T....T.....T....G....N....R...D....II...RI.E.HM.R.R..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........A........M........P......S........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
H0JKW6_9NOCA/247-409             ..............................NKYGTRHSLL..DGI...N....R..G..T.D.V...L...IGG...K.....A.....AL.VC.G.Y.G.D.............VGKGCAE.ALR.GQG.A...R...V.S.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........M...M....D......G.......Y....D.....V.....V.............T.............V.......E............D.........F............I...G...............Q........A.....D...I.....V.....I....T....A.....T....G....N....K...D....II...TF.E.HM.K.A..MKH.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERA...aDV..........T.R.IN.I.K.P......Q......VD...E.........F..........T........F........A......D........G.............H....S........IIVLSE..GRLLNLGNATG...........................................................................
B2ACR6_PODAN/190-351             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....I.....GV.VA.G.F.G.D.............VGKGCAL.ALQ.GMG.A...R...V.L.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....A......G.......F....Q.....V.....T.............T.............M.......E............K.........A............A...K...............V........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.K.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..A.W.L.KAN....AQ..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........K......N........G.............R....H........VILLAE..GRLVNLGCATG...........................................................................
H5ULL4_9ACTO/248-409             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............D.........A............I...G...............N........A.....D...I.....V.....I....T....S.....T....G....N....L...G....II...TL.E.HM.R.A..MKH.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........K.R.IT.V.K.P......Q......VD...Q.........W..........I........F........E......N........G.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
SAHH_MESCR/240-403               ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....GV.VC.G.Y.G.D.............VGKGCAL.ALK.AAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......F....Q.....I.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ENY...pGV..........K.R.IT.I.K.P......Q......TD...R.........F..........V........F........P......E.......tN.............T....G........IIVLAE..GRLMKLGCATG...........................................................................
A4HPQ8_LEIBR/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....CC.VC.G.Y.G.D.............VGKGCAA.ALR.AFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....A.............L.............V.......E............D.........V............M...T...............D........A.....H...I.....F.....V....T....T.....T....G....N....D...D....IL...TS.A.HF.P.H..MRD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..E.W.L.QAN....AK..........E.H.VE.I.K.P......Q......VD...R.........Y..........T........M........E......S........G.............R....H........IILLAK..GRLVNLGCANG...........................................................................
I0S2P9_MYCPH/244-405             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....AL.VC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.A.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............D.........F............I...G...............E........A.....D...I.....V.....I....T....A.....T....G....N....K...D....II...TL.E.HM.K.A..MKN.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.A.L.ERS....GA..........K.K.LN.I.K.P......Q......VD...L.........W..........T........F........E......D........G.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
SAHH_SOLUE/234-395               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.IC.G.Y.G.D.............VGKGSAH.SLR.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............I.......E............D.........T............L...G...............R........G.....D...I.....Y.....V....T....C.....T....G....N....C...E....II...TL.E.HM.R.L..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....M..D.R.L.NES....DA..........K.R.LQ.I.K.P......Q......VD...M.........Y..........T........F........P......G........G.............S....S........IFILAE..GRLVNLGCATG...........................................................................
F3GX18_PSESX/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidgendgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DS.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgpgsfdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
C3N5P5_SULIA/203-364             ..............................NRYGTGQSAI..DGI...L....R..A..T.N.I...L...IAG...K.....I.....TV.VA.G.Y.G.W.............VGRGIAN.RLR.GMG.A...R...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........V...M....D......G.......F....D.....V.....M.............P.............I.......A............E.........A............S...K...............V........G.....D...I.....F.....V....T....A.....T....G....N....T...K....AI...RV.E.HI.L.N..MKD.GA..IL..S.N.....A...G..H...FN..VEV.D.....V..K.G.L.KET....AV..........K.V.RN.I.R.P......Y......VD...E.........Y..........T........L........P......N........G.............K....K........VYLLAD..GRLVNLAAAE-g..........................................................................
B2IFN0_BEII9/230-389             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AM.IA.G.F.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............D.........A............A...T...............R........A.....D...I.....F.....V....T....C.....T....G....N....V...D....VI...TV.D.HM.R.L..MKD.RA..IV..C.N.....I...G..H...FD..SEI.Q.....V..A.G.L.RNF....--..........K.W.EN.V.K.P......Q......VD...E.........I..........V........F........P......D........G.............K....R........IILLSE..GRLVNLGNATG...........................................................................
H2J7S2_MARPK/177-338             ..............................NRYGTGQSTW..DGI...I....R..S..T.N.L...T...VAG...K.....N.....VV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...R...V.I.....V..T.....E...V..D.......P....I...K........A......I....E....A.........V...M....D......G.......F....S.....V.....M.............P.............M.......D............E.........A............A...K...............I........G.....D...F.....F.....V....T....V.....T....G....D....I...D....VI...TE.K.HF.M.M..MKD.GV..VL..A.N.....A...G..H...FD..IEV.K.....V..A.D.L.ERI....NT..........E.K.KE.V.R.P......G......VT...Q.........Y..........T........M........P......N........G.............N....K........LYLLGM..GRLVNLVNG--dg.........................................................................
D5CU83_SIDLE/229-388             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.IC.G.Y.G.D.............VGKGSAQ.AMR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....F...H....VI...TH.D.HM.A.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EKY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAK..GRLVNLGCGTG...........................................................................
F2T0V4_TRIRC/194-302             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAE.ALR.SMG.A...A...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....A......G.......Y....Q.....V.....L.............T.............M.......E............E.........A............A...P...............K........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.E.HF.N.V..MKN.DA..IV..C.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------sk.........................................................................
G2E443_9GAMM/229-388             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....TM.VC.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....I..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............D.........A............A...P...............V........A.....D...I.....F.....V....T....T.....T....G....N....K...N....II...TH.D.HM.A.A..MKN.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.V.SKY....--..........D.W.EE.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IIMLAQ..GRLVNLGCATG...........................................................................
B9JXY0_AGRVS/270-429             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.SLI.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............R.............L.......E............D.........V............V...K...............T........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..V.A.L.KNL....--..........K.W.VN.I.K.P......Q......VD...M.........I..........E........F........P......A........G.............N....R........MILLSE..GRLLNLGNATG...........................................................................
Q7KSG0_DROME/252-413             .............................t-FYTCRDSIL..DSL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.D.............VGKGCAQ.SLK.GQG.C...I...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....R.....V.....V.............R.............L.......N............E.........V............I...R...............T........V.....D...V.....V.....V....T....A.....T....G....N....K...N....VI...TR.D.HM.N.R..MKN.GC..IL..C.N.....M...G..H...SC..SEI.D.....V..N.G.L.HTP....EL..........T.W.ER.V.R.S......Q......VD...H.........I..........R........W........P......D........G.............R....M........IILLAE..GRLVNLSCST-i..........................................................................
A5IKP9_THEP1/174-335             ..............................NRYGTGQSTW..DAI...M....R..N..T.N.L...L...VAG...K.....N.....VV.VA.G.Y.G.W.............CGRGIAL.RAA.GLG.A...K...V.I.....V..T.....E...V..D.......P....V...K........A......V....E....A.........I...M....D......G.......F....T.....V.....M.............P.............M.......R............E.........A............V...K...............I........A.....D...F.....V.....V....T....A.....T....G....N....T...D....VL...SK.E.DI.L.S..LKD.GA..VL..A.N.....A...G..H...FN..VEI.P.....V..R.V.L.EEI....AI..........E.K.FE.A.R.P......N......VT...G.........Y..........T........L........E......N........G.............K....T........VFLLAE..GRLVNLAAG--dg.........................................................................
C7M131_ACIFD/185-352             ..............................NRYGTGQSAL..DGI...I....R..A..T.N.V...L...LAG...T.....T.....VV.VA.G.Y.G.F.............CGKGVAS.RAR.GMG.A...Q...V.V.....V..T.....E...I..D.......P....V...A........A......L....E....A.........V...M....D......G.......F....R.....V.....E.............P.............M.......E............E.........A............A...A...............E........G.....D...I.....F.....I....T....V.....T....G....N....R...D....VI...RP.E.HV.R.R..MKD.GA..LL..A.N.....A...G..H...FD..VEI.D.....L..E.G.L.ARLa..pGE..........R.R.RP.V.R.P......M......VE...E.........Y..........L........V........D......Ses....gtT.............A....R........VMVVAE..GRLVNLSAAEG...........................................................................
G0THM5_MYCCP/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
B7WX05_COMTE/236-395             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AC.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...RH.E.HM.V.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EKY....--..........K.W.EE.V.K.P......Q......VD...Q.........I..........E........F........P......D........G.............K....K........ITLLAK..GRLVNLGCATG...........................................................................
SAHH_BARHE/226-385               ..............................NKYGCRESLV..DGI...R....R..A..T.D.V...M...IAG...K.....T.....AI.VC.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....V.............N.............L.......D............D.........A............A...S...............S........A.....D...I.....I.....I....T....T.....T....G....N....K...D....IV...RL.D.HM.R.K..VKD.MC..IL..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.QNL....--..........P.W.TN.I.K.P......Q......VD...M.........I..........T........F........P......D........G.............K....R........IILLSE..GRLLNLGNATG...........................................................................
F2L4F5_THEU7/204-366             ..............................NRYGTGQSTW..DGI...M....R..A..A.N.A...L...IAG...K.....V.....VV.VA.G.Y.G.W.............VGKGIAA.RAR.GLG.A..rR...V.I.....V..T.....E...V..N.......P....I...R........A......L....E....A.........V...F....D......G.......F....E.....V.....M.............P.............M.......S............Q.........A............A...E...............I........G.....D...V.....F.....I....T....A.....T....G....D....I...R....VI...DL.D.DI.L.R..MKD.GA..IL..A.N.....A...G..H...FN..VEI.D.....V..E.G.L.ERI....AK..........S.K.RT.I.R.P......Y......LD...E.........Y..........E........L........P......G........G.............K....R........VYLIGE..GRLVNLVAAE-g..........................................................................
F7H6W0_MACMU/369-530             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
H8KN95_SOLCM/201-362             ..............................NKYGCRESLV..DAI...R....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAE.SLS.SAG.V...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............K.............M.......K............D.........A............V...K...............E........A.....D...I.....V.....V....T....A.....T....G....N....F...N....IV...TG.E.HF.K.S..LKD.KA..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NKN...yGN..........T.K.IE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............N....D........VIVLAE..GRLVNLGCATG...........................................................................
D0CC64_ACIBA/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
G4JND2_9CREN/184-346             ..............................NRYGTGQSTF..DGI...L....R..A..T.N.I...L...IAG...K.....I.....VV.VA.G.Y.G.W.............VGKGIAM.RAR.GLG.A..rR...V.I.....V..T.....E...V..N.......P....I...R........A......L....E....A.........I...Y....D......G.......F....E.....V.....M.............P.............M.......S............E.........A............A...E...............I........G.....D...I.....F.....I....T....A.....T....G....N....K...A....VI...RR.E.HF.E.K..MKN.GA..IL..A.N.....A...G..H...FN..VEV.W.....I..P.D.L.EEL....AR..........S.K.RH.M.L.P......Y......VT...E.........Y..........E........L........R......D........G.............R....K........IYLLAE..GRLVNLVAAE-g..........................................................................
H8JCU5_MYCIT/248-410             ..............................NKYGCRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGSAE.SVA.GQG.A...R...V.T.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....E......G.......F....D.....V.....K.............R.............V.......E............D.........V............I...G...............E........A.....D...I.....I.....I....T....T.....T....G....N....K...D....II...TL.E.HM.K.A..MKD.KA..IL..G.N.....I...G..H...FD..NEI.Q.....I..A.R.L.EKS....GA..........T.K.TN.I.R.P......Q......VD...L.........W..........T........F........P......D.......tG.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
F1MWH2_BOVIN/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
B4VSC6_9CYAN/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....IV.IA.G.Y.G.W.............CGKGAAM.RAR.GMG.A...N...V.I.....V..T.....E...I..D.......P....I...K........G......I....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......I............E.........A............A...S...............H........G.....D...V.....F.....I....T....V.....T....G....N....K...H....VI...RP.E.HF.E.V..MKD.GA..MV..C.N.....S...G..H...FD..IEI.D.....L..K.S.L.AEL....ST..........E.Y.RQ.V.R.N......F......TQ...Q.........Y..........F........L........K......N........G.............K....S........IIVLGE..GRLINLAAAE-g..........................................................................
Q6BHB2_DEBHA/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALR.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....A.............P.............L.......E............E.........V............A...S...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...TG.V.HF.E.Q..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....SE..........S.V.VE.I.K.P......Q......VD...R.........F..........L........M........K......N........G.............R....H........VILLAE..GRLVNLGCATG...........................................................................
SAHH_MARMM/230-389               ..............................NRYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....K.....AL.VF.G.Y.G.D.............VGKGSAE.SLA.GAG.A...R...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....E.....V.....V.............R.............A.......E............D.........V............I...G...............E........M.....D...I.....F.....V....T....A.....T....G....N....K...D....IL...TV.D.HM.R.A..MKD.MA..IV..C.N.....I...G..H...FD..NEI.Q.....V..E.S.L.KNY....--..........Q.W.TN.V.K.P......Q......VD...L.........V..........N........F........P......E........G.............H....R........IILLSE..GRLVNLGNATG...........................................................................
H6REB5_9BACT/226-385             ..............................NKYGCRESAV..DAI...R....R..A..T.D.I...M...LAG...K.....R.....IV.VC.G.Y.G.D.............VGKGTAA.SFK.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............K.............L.......E............T.........V............I...A...............N........A.....D...I.....I.....I....T....T.....T....G....N....K...D....IV...QA.R.HF.E.A..MKD.KT..IV..C.N.....I...G..H...FD..NEI.D.....V..T.W.L.NDN....-H..........E.K.TE.I.K.P......Q......VD...K.........Y..........T........V........-......N........G.............K....D........IILLAE..GRLVNLGCATG...........................................................................
Q5LLR0_SILPO/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....T.............T.............L.......E............D.........E............V...A...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKN.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............N....K........IILLSE..GRLLNLGNATG...........................................................................
G0ETD1_CUPNN/231-390             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AI.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.I.EKY....--..........E.W.DE.I.K.P......Q......VD...H.........V..........K........F........P......D........G.............K....K........LIILAK..GRLVNLGCATG...........................................................................
D3E562_GEOS4/190-351             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...V...VAG...K.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.I.....V..T.....E...I..D.......P....I...K........A......V....E....A.........Y...M....D......G.......F....H.....V.....M.............P.............M.......R............E.........A............A...K...............R........G.....D...F.....F.....V....T....V.....T....G....N....R...D....VI...SG.E.DF.D.V..MKD.GA..IL..S.N.....A...G..H...FD..VEV.N.....K..P.D.L.SER....SQ..........S.V.RT.V.R.R......N......IE...E.........Y..........H........L........K......D........G.............R....K........IYLLAE..GRLVNLAAG--dg.........................................................................
SAHH_MYCBO/253-415               ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
F1WCC6_MORCA/208-381             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LAG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............Spfing...epsqgV.......N...........tT.........L............L...Q...............D........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...NS.D.ML.T.A..LKS.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..N.F.M.RDN....-W..........R.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Dd......eR.............D....Y........LLVLSE..GRLVNLGNATG...........................................................................
E4M1Z5_9FIRM/188-349             ..............................NRYGTGQSVW..DGI...M....R..L..T.N.L...V...VAG...K.....T.....VV.VC.G.Y.G.W.............CGKGVAE.RAR.GLG.A...R...V.V.....V..C.....E...V..D.......P....I...R........A......N....E....A.........L...M....D......G.......H....Q.....V.....M.............P.............S.......D............E.........A............A...A...............L........G.....D...V.....F.....V....T....V.....T....G....C....R...D....VL...VE.R.HF.R.R..MKD.GA..LL..A.N.....A...G..H...FD..VEI.A.....K..A.D.L.EAL....AQ..........R.V.EE.A.R.P......G......VR...T.........Y..........L........L........P......G........G.............R....R........LHLLAD..GRLVNLAG---gdg........................................................................
F5IP14_ACIBA/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
G3W7X0_SARHA/268-429             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
F8ICH2_ALIAT/181-342             ..............................NRYGTGQSVW..DGF...M....R..T..T.N.L...M...IAG...K.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAR.GLG.A...Q...V.V.....V..C.....E...V..D.......P....I...R........A......V....E....A.........V...M....E......G.......F....R.....V.....M.............P.............I.......R............E.........A............A...E...............V........G.....D...I.....F.....I....A....V.....T....G....N....K...A....VI...SR.D.AM.E.R..MKD.GA..IL..G.N.....A...G..H...FD..VEV.D.....K..E.A.L.SDL....AV..........E.V.RT.A.R.P......N......VD...E.........Y..........R........L........A......D........G.............R....R........LYLIAE..GRLVNLAAG--dg.........................................................................
E8NG30_MICTS/183-344             .............................n-RHGTGQSVV..FAV...A....D..V..A.D.R...S...LRG...A.....T.....VV.VV.G.Y.G.R.............VGSGIAE.HAA.ALG.A...R...V.I.....V..T.....E...T..D.......P....V...A........A......L....Q....A.........A...F....A......G.......F....A.....V.....R.............T.............L.......A............Q.........A............A...A...............E........A.....D...V.....V.....I....S....A.....T....G....I....R...H....TV...DV.A.HL.D.A..LPT.GA..IV..A.V.....G...G..G...VS..QEI.A.....L..D.A.A.RAA....GA..........I.E.IA.R.D.G......A......VS...T.........L..........R........M........P......S........G.............S....L........VHVLDD..GNCLNVSAAE-g..........................................................................
A7XB36_PETHY/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAM.SLK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...A...............D........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETF...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
D5U359_THEAM/185-347             ..............................NRYGTGQSTF..DGI...L....R..A..T.N.I...L...VAG...K.....V.....VV.VA.G.Y.G.W.............VGKGIAL.RAR.GLG.A..rR...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........V...H....D......G.......F....E.....V.....M.............K.............M.......I............E.........A............A...P...............I........G.....D...V.....F.....I....T....A.....T....G....N....K...A....VI...RG.E.HF.Q.L..MKD.GA..LL..A.N.....A...G..H...FN..VEV.W.....I..Q.D.L.EKL....SV..........R.K.RL.I.R.S......N......VE...E.........Y..........E........L........R......D........G.............R....R........IYLLAE..GRLVNLAAAE-g..........................................................................
F0C4M1_9XANT/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........G.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NAL...sGV..........E.K.IN.I.K.P......Q......VD...K.........Y..........V........F........G......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
SAHH_DESDG/238-400               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....T.....VV.VL.G.Y.G.D.............VGKGCAH.SMR.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......D............E.........A............A...P...............E........G.....D...I.....F.....V....T....A.....T....G....N....F...K....VI...TG.E.HM.E.R..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....M..A.Y.L.EDS...tEC..........S.C.LN.I.K.P......Q......VD...K.........W..........T........L........K......S........G.............R....S........IIVLAE..GRLVNLGCATG...........................................................................
H0IUD9_MYCAB/249-411             ..............................NKYGTRHSLV..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............Q.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....F...D....II...LL.E.HM.K.A..MKD.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.A.L.EKS....GA..........V.R.LN.I.K.P......Q......VD...L.........W..........T........F........G......D.......sG.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
C0E124_9CORY/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............T.............V.......D............T.........A............I...R...............D........A.....D...L.....V.....I....T....A.....T....G....N....L...G....II...TF.E.QM.L.E..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHR...dDV..........T.R.VN.I.K.P......Q......VD...E.........F..........H........L........P......N........G.............R....A........IIVLSE..GRLLNLGNATG...........................................................................
G7H286_9ACTO/255-417             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............Q.........A............I...A...............D........A.....D...I.....V.....I....T....S.....T....G....N....L...G....II...TF.E.HM.Q.K..MKN.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ESA...dGM..........R.R.IN.I.K.P......Q......VD...Q.........W..........I........F........P......D........G.............H....C........IIVLSE..GRLVNLGNATG...........................................................................
H8Z1A0_9GAMM/234-393             ..............................NLYGCRESLV..DAI...K....R..A..T.D.V...M...IAG...K.....V.....GI.VC.G.Y.G.D.............VGKGSAA.ALR.ALG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............R.............L.......D............E.........V............A...N...............Q........G.....D...I.....F.....V....T....T.....T....G....N....L...D....II...TH.D.HM.A.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..Q.S.L.AKY....--..........E.W.VN.I.K.P......Q......VD...Q.........I..........I........F........P......D........G.............H....R........ITLLAQ..GRLVNLGCATG...........................................................................
G3J113_9GAMM/187-348             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....FT.VA.G.Y.G.W.............CGRGIAM.RAK.GHG.A...Q...V.I.....I..T.....E...V..E.......P....L...R........A......L....E....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......L............E.........A............A...A...............I........S.....D...F.....I.....V....T....A.....T....G....D....K...H....VL...DK.A.HF.E.V..IKD.GC..VI..A.N.....S...G..H...FN..VEI.N.....I..P.A.L.EKL....AV..........T.K.HR.P.R.T......G......VE...A.........Y..........Q........L........K......D........G.............R....I........VRLLAE..GRLVNLAAAE-g..........................................................................
H2Z7J0_CIOSA/214-375             ..............................NLYSCRESVL..DGL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.E.............VGKGCCS.ALK.GLG.A...V...S.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......I....R.....V.....V.............R.............L.......H............E.........V............V...K...............T........A.....D...I.....F.....I....T....C.....S....G....N....K...N....VI...TR.E.SL.D.K..MKN.GA..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.KTN....DL..........T.W.EK.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
G6XU52_RHIRD/227-386             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLQ.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............R.............L.......E............D.........V............V...S...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.RNL....--..........K.W.TN.I.K.P......Q......VD...M.........I..........E........F........P......K........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
A0DP58_PARTE/276-353             ............iiihidsfqyfnyllkii----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............K........N.....K...Y.....F.....Y....Y....C.....Y....G....N....K...E....II...NP.L.HM.S.Q..MKH.NA..IV..G.K.....I...G..H...FD..VEI.D.....M..K.V.L.RQW...eGI..........K.K.VE.V.K.P......L......C-...-.........-..........-........-........-......-........-.............-....-........------..-----------d..........................................................................
H9KB63_APIME/192-353             ..............................NLYGCRESLI..DGI...K....R..A..T.D.I...M...IAG...K.....V.....CV.VA.G.Y.G.D.............VGKGCAQ.SLK.AFG.G...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............S...R...............K........G.....H...I.....Y.....V....T....S.....T....G....C....K...N....II...TS.N.HF.L.N..MPE.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..A.W.L.KQN....AI..........E.K.VN.I.K.P......Q......VD...R.........Y..........Q........L........K......N........K.............R....H........IIVLAD..GRLVNLGCATG...........................................................................
A3RPV6_RALSL/231-390             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.V.EKY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....K........IIILAK..GRLVNLGCATG...........................................................................
Q80WX1_MOUSE/3-108               ............................rg----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........V......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
C7KPI8_ACEPA/189-348             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............E.........G............A...P...............R........G.....D...I.....F.....V....T....A.....T....G....N....V...D....VI...TL.D.HM.R.A..MKN.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..N.A.L.RNF....--..........T.W.DN.I.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
Q4D455_TRYCC/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AC.VC.G.Y.G.D.............VGKGCAA.ALR.AFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....L.............L.............V.......E............D.........I............V...E...............Q........A.....H...I.....F.....V....T....T.....T....G....N....D...D....II...TA.E.HF.P.R..MQD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..S.W.L.KAN....AK..........E.R.VE.V.K.P......Q......VD...R.........Y..........T........M........H......N........G.............R....H........IILLAE..GRLVNLGCASG...........................................................................
F3KU88_9BURK/235-394             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...S....II...TH.D.HM.V.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.I.EKY....--..........K.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IIMLAK..GRLVNLGCGTG...........................................................................
G6FV46_9CYAN/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....LV.VV.G.Y.G.W.............CGKGTAL.RAR.GLG.A...N...V.I.....V..T.....E...I..D.......P....I...K........A......I....E....A.........V...M....D......G.......F....R.....V.....L.............P.............M.......A............E.........A............A...P...............L........G.....D...L.....F.....I....T....V.....T....G....N....K...H....VI...RG.E.HF.D.V..MKD.GA..IV..C.N.....S...G..H...FD..IEI.D.....L..K.A.L.GAK....AT..........E.V.KT.V.R.P......F......TE...E.........Y..........R........L........Q......N........G.............K....S........VVVLGE..GRLINLAAAE-g..........................................................................
A4LN87_BURPE/234-393             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
I1QZZ3_ORYGL/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tN.............T....G........IIVLAE..GRLMNLGCATG...........................................................................
G2N7Q5_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
F8CBS0_MYXFH/236-395             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....K...G....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.S.L.EKY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........N.............K....R........IILLAK..GRLVNLGCGTG...........................................................................
Q2J4J2_FRASC/236-398             ..............................NKYGCRHSVI..DGL...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAD.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......E............D.........V............V...A...............T........A.....D...I.....F.....V....T....T.....T....G....N....F...N....II...HA.E.HM.A.A..MKH.QA..IV..S.N.....I...G..H...FD..NEI.D.....M..A.G.L.ART...pGI..........E.K.IN.I.K.P......Q......VD...E.........W..........V........F........P......D........G.............H....S........IIVLAE..GRLMNLGCATG...........................................................................
F4QKH0_9CAUL/233-392             ..............................NLYGCRESLV..DAI...R....R..A..T.D.V...M...LAG...K.....V.....AV.VL.G.Y.G.D.............VGKGSAA.SLR.NGG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....R.............T.............V.......E............D.........V............A...S...............A........A.....D...I.....F.....V....T....A.....T....G....N....K...D....VL...RL.E.HM.R.A..MKH.NA..IV..C.N.....I...G..H...FD..SEI.Q.....I..S.S.L.RNY....--..........K.W.DE.I.K.P......Q......VH...H.........V..........E........F........P......D........G.............K....K........IIVLSE..GRLVNLGNATG...........................................................................
D9U9W1_DIDMA/7-24                ..............................NLYCCRESIL..DGL...K....R..T..T.D.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
B9Q7N9_TOXGO/232-395             ..............................NVYGCRHSLP..DGI...M....R..A..T.D.V...M...LGG...K.....R.....VV.IC.G.F.G.D.............VGKGCAA.AMK.GAG.A...R...V.V.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....S.....V.....S.............T.............L.......E............S.........Q............L...A...............T........A.....D...I.....F.....I....S....A.....T....G....N....K...D....II...TA.R.HM.S.Q..MKN.NA..IV..G.N.....I...G..H...FD..NEV.D.....M..A.G.L.LAW...pGI..........Q.K.VN.I.K.P......Q......VD...R.........F..........I........F........P......E.......dN.............H....G........VIVLAE..GRLLNLGCATG...........................................................................
E2A3R3_CAMFO/265-426             ..............................NLYGCRESLI..DGI...K....R..A..T.D.I...M...IAG...K.....V.....CV.VA.G.Y.G.D.............VGKGCAQ.SLR.AFG.G...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............S...T...............K........G.....Q...I.....Y.....V....T....T.....T....G....C....K...D....IV...VG.R.HF.M.N..MPN.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..T.W.L.EKN....AV..........E.K.IN.I.K.P......Q......VD...R.........Y..........H........L........E......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
SAHH_DELAS/236-395               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............W.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....R...D....II...RH.E.HM.V.A..MKN.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EQY....--..........Q.W.EE.I.K.P......Q......VD...H.........I..........T........F........P......D........G.............K....K........IILLAK..GRLVNLGCATG...........................................................................
Q5CBE4_9THEM/183-344             ..............................NRYGTGQSTW..DAI...M....R..N..T.N.L...L...IAG...K.....R.....VV.VA.G.Y.G.W.............CGRGIAL.RAS.GLG.A...K...V.I.....V..T.....E...V..D.......P....I...R........A......V....E....A.........I...M....D......G.......F....E.....V.....M.............P.............M.......K............E.........A............V...E...............L........A.....D...F.....V.....V....T....A.....T....G....N....T...D....VL...TE.E.DI.L.S..LKD.GA..VL..A.N.....A...G..H...FN..VEI.P.....V..E.T.L.ERL....AV..........E.K.FE.A.R.P......N......VT...G.........Y..........V........L........K......N........G.............K....T........VFLLAE..GRLVNLAG---gdg........................................................................
SAHH_CHLCH/231-393               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....TV.VL.G.Y.G.D.............VGKGCAH.SMR.SYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....A.............T.............M.......E............D.........A............V...H...............E........G.....N...I.....F.....V....T....T.....T....G....N....K...D....VI...TL.E.HM.K.Q..MRD.EA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.K.L.NND...pTV..........K.I.IN.I.K.P......Q......VD...K.........Y..........I........F........P......N........G.............N....C........MYLLAE..GRLVNLGCATG...........................................................................
A4BYB4_9FLAO/197-358             ..............................NKYGCKESAV..DAI...R....R..A..T.D.T...M...LAG...K.....R.....VT.VC.G.Y.G.D.............VGKGTAA.SFK.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............R.............L.......E............T.........V............V...A...............N........S.....D...I.....V.....I....T....T.....T....G....N....K...D....II...QA.H.HF.E.A..MKD.KV..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NKN...hGH..........T.K.DT.I.K.P......Q......VD...K.........Y..........N........V........-......N........G.............K....D........IILLAE..GRLVNLGCATG...........................................................................
D3SE55_THISK/231-390             ..............................NLYGCRESTV..DSI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGAAQ.SLA.GLG.A...T...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....R.....V.....V.............T.............M.......D............E.........A............A...D...............K........A.....E...I.....F.....V....T....A.....T....G....N....K...D....VI...TE.D.HM.T.R..MKD.QA..IV..C.N.....I...G..H...FD..SEI.A.....V..A.A.M.RKY....--..........E.W.EN.I.K.P......Q......VD...H.........I..........I........L........P......N........G.............N....R........IIMLAE..GRLVNLGCGTG...........................................................................
E4Z315_OIKDI/91-252              ..............................NLYSCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....S.....VS.VC.G.Y.G.E.............VGKGCAA.ALK.GMG.A...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....Q.............T.............I.......E............D.........I............A...D...............T........A.....D...V.....F.....I....T....C.....T....G....N....R...N....VI...TR.K.HM.D.K..MKN.GA..VV..A.N.....M...G..H...SN..TEI.E.....V..S.S.L.KTK....DL..........V.W.EK.V.R.S......Q......VD...H.........I..........I........W........Q......D........G.............K....R........IVLLAE..GRLLNYSCSS-v..........................................................................
B5HIQ1_STRPR/232-394             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............L.......D............E.........V............V...E...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.S.DM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AQL...pGV..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
Q0G6R0_9RHIZ/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGAAL.SLH.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......E............D.........A............G...P...............N........A.....D...I.....I.....I....T....T.....T....G....N....K...D....IV...TL.D.HM.R.S..FKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..G.A.L.RNH....--..........Q.W.TK.I.K.P......Q......VD...M.........I..........S........F........P......D........G.............K....R........MILLSE..GRLLNLGNATG...........................................................................
G3VVH8_SARHA/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
SAHH_CORDI/236-398               ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............H.............V.......D............Q.........A............I...G...............D........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.A..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHR...dDV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............K....S........IVVLSE..GRLLNLGNATG...........................................................................
H8LQE5_CORPS/237-399             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............T.............V.......D............Q.........A............I...S...............E........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.K..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.LlHRN....DV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............N....A........IIVLSE..GRLLNLGNATG...........................................................................
C6XL65_HIRBI/226-385             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....T.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....T.............T.............L.......E............K.........T............V...K...............D........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.N.L.KNL....--..........K.M.TN.I.K.D......Q......VD...M.........Y..........E........L........P......S........G.............N....R........MILLSQ..GRLLNLGNATG...........................................................................
Q4RXQ1_TETNG/250-411             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....I.....I....T....C.....T....G....N....K...N....VV...TR.D.QL.D.R..MKN.AS..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IILLAE..GRLLNLSCST-v..........................................................................
G7YXQ7_CLOSI/107-216             ......................ffpvhlik----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............A.......E............E.........A............V...K...............Q........A.....R...L.....F.....I....S....A.....T....G....C....C...N....IL...TG.E.HF.P.H..MLD.DA..IV..C.N.....I...G..H...FD..TEV.D.....V..K.W.L.NAN....CV..........K.K.EQ.V.K.P......Q......VD...R.........Y..........T........L........E......N........G.............K....H........IIVLAE..GRLVNLGCAHG...........................................................................
D9XJ79_9ACTO/169-327             .......................grsivfs---------T..DAL...V....R..A..R.G.D...I...LTS...R.....S.....AC.VI.G.F.G.K.............IGRSIAQ.TLR.AQD.L...R...V.T.....V..Y.....D...N..D.......A....V...K........R......V....Q....A.........H...A....L......G.......F....H.....T.....S............aS.............T.......T............E.........A............V...H...............D........A.....D...L.....V.....L....C....A.....T....G....N....L...A....-L...RH.E.DF.A.A..LRN.GA..YL..G.S.....V...T..S...SE..DEL.E.....L..G.S.L.DDL....-Y..........E.R.QP.V.G.P......Q......LT...R.........Y..........E........V........T......-........G.............H....Y........FYVLAD..GGAVNF-----vhgaav.....................................................................
G8NVU2_GRAMM/235-397             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GLG.A...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............I.......E............E.........T............L...G...............R........G.....D...I.....Y.....V....T....C.....T....G....N....L...D....II...TL.E.HM.R.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....M..A.E.L.DGA...kDA..........K.K.TN.I.K.P......Q......VD...Q.........Y..........T........F........D......T........G.............N....S........IFVLAE..GRLVNLGCATG...........................................................................
A5ZB66_9BACE/236-398             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............D.........A............C...T...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...aGI..........K.C.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
SAHH_BURTA/234-393               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
F6GTM7_VITVI/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.QAG.A...Q...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......I....P.....V.....L.............T.............L.......E............D.........V............V...S...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.H.HM.K.Q..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tN.............S....G........IIILAE..GRLMNLGCATG...........................................................................
B6ATE2_9RHOB/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VM.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......E............D.........A............V...E...............T........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.A..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......N........G.............H....R........LILLSE..GRLLNLGNATG...........................................................................
A4FGJ3_SACEN/244-406             ..............................NKYGCRHSLV..DGI...N....R..G..T.D.V...L...IGG...K.....T.....AV.IC.G.F.G.D.............VGKGSAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............T.............I.......E............D.........V............V...E...............Q........A.....D...I.....F.....I....T....T.....T....G....N....F...N....II...TA.E.HM.A.K..MKH.NA..IV..G.N.....V...G..H...FD..NEI.D.....M..A.G.L.EKV...pGI..........K.K.VE.I.K.P......Q......VH...E.........Y..........T........F........P......D........G.............H....A........IIVLSE..GRLLNLGNATG...........................................................................
A3JM62_9RHOB/224-383             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VM.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...S...............D........A.....D...V.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HL.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........L........P......N........G.............N....R........LILLSE..GRLLNLGNATG...........................................................................
SAHH_PLAYO/234-396               ..............................NIYGCRHSLP..DGL...M....R..A..T.D.F...L...ISG...K.....I.....VV.IC.G.Y.G.D.............VGKGCAS.AMK.GLG.A...R...V.Y.....V..T.....E...I..D.......P....I...C........A......I....Q....A.........V...M....E......G.......F....N.....V.....V.............T.............L.......E............E.........I............V...E...............K........G.....D...F.....F.....I....T....C.....T....G....N....V...D....II...KL.E.HL.L.K..MKN.NA..VV..G.N.....I...G..H...FD..DEI.Q.....V..S.D.L.FNH...eGI..........E.I.EN.V.K.P......Q......VD...R.........V..........T........L........P......N........G.............N....K........IIVLAQ..GRLLNLSCATG...........................................................................
D9UQ05_9ACTO/244-406             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............L.......D............D.........V............V...D...............K........G.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.S.DM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKI...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........P......D........G.............K....K........IIVLSE..GRLLNLGNATG...........................................................................
A1D366_NEOFI/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAD.ALR.SMG.A...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....Q......G.......Y....Q.....V.....V.............T.............M.......E............E.........A............A...P...............Q........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.K.HF.E.V..MRN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........Y..........L........M........P......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
G0BV78_9ENTR/175-324             .........................whtff----------..---...-....Q..T..T.H.L...T...LHE...K.....C.....VL.VI.G.Y.G.L.............VGQGVAA.AAK.AYG.G...Q...V.I.....V..A.....E...I..D.......P....A...R........A......L....Q....A.........R...Y....D......G.......W....A.....V.....V.............D.............L.......A............T.........A............V...T...............Q........A.....D...V.....I.....A....T....A.....T....G....A....K...N....VL...SA.Q.HL.Q.Q..VKD.GV..FI..L.N.....V...G..H...VA..AEI.D.....V..D.F.L.KNL....--..........P.H.SE.P.M.S......F......VN...A.........Y..........Q........L........G......D........-.............K....K........IYLLAN..GSMFNLTAG--yg.........................................................................
A6EFW6_9SPHI/197-358             ..............................NKYGCRESLV..DAI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAE.SLS.SQG.V...R...V.I.....V..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............K.............F.......A............T.........A............V...K...............E........A.....D...I.....I.....V....T....T.....T....G....N....C...D....IV...RA.E.HF.K.T..MKD.KA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.W.L.NTN...yGN..........T.K.VE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IILLAE..GRLVNLGCATG...........................................................................
SAHH_RHOCB/224-383               ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...A...............D........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............A....R........IILLSE..GRLLNLGNATG...........................................................................
SAHH_PSEP1/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spf........idgI.......N............Dgt.....eaS............I...Dka..........llgK........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........V..........H........RtgagsfdpQ......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
D8VMB1_9NEOP/53-213              ..............................NLYGCRESLL..DGI...K....R..A..T.D.I...M...IAG...K.....V.....CV.VG.G.Y.G.D.............VGKGCAQ.AFK.GFG.G...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....Q.....V.....T.............T.............M.......D............E.........A............A...E...............I........G.....Q...I.....F.....V....T....T.....T....G....N....I...D....II...CK.E.HF.V.K..MKD.DA..IV..C.N.....I...G..H...FD..CEV.D.....V..A.W.L.DNN....-A..........K.K.VN.I.K.Q......H......VD...R.........Y..........E........L........E......N........G.............N....H........IIVLAS..GRLVNLGCATG...........................................................................
F8F6X8_PAEMK/135-261             ...................ptaegaimmai----------..---...-....Q..N..T.D.I...T...IHG...S.....T.....AM.VL.G.F.G.R.............TGITLAR.TLQ.GMG.A...R...V.K.....V..G.....V...N..K.......P....E...Y........F......A....R....A.........YemgL....N......P.......F....H.....T.....E.............E.............L.......K............Q.........Q............A...S...............K........V.....D...Y.....V.....-....F....N.....T....I....P....A...P....II...TA.Q.VI.A.Q..MPH.RA..LI..I.D.....L...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------asrpggtdfrfaekrgvka........................................................
D1NJ48_CLOTM/184-345             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...I...VAG...K.....N.....VV.VV.G.Y.G.W.............CGKGIAM.RAK.GLG.A...S...V.I.....V..C.....E...V..D.......P....I...K........A......A....E....A.........V...M....D......G.......Y....K.....V.....M.............P.............M.......M............E.........A............A...K...............I........G.....D...L.....F.....I....T....A.....T....G....C....S...R....VI...HR.E.HF.K.V..MKD.GA..IL..C.N.....A...G..H...FD..VEV.S.....V..K.D.L.EEM....AV..........R.K.EE.Q.R.K......N......IM...G.........Y..........M........M........E......D........G.............R....W........INLLAE..GRLVNLAAG--dg.........................................................................
E1TCG9_BURSG/234-393             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
SAHH_STRAZ/227-389               ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............E.........V............V...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.S.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AQI...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........K........F........P......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
C7LQI3_DESBD/233-395             ..............................NLYGCRESLA..DGI...K....R..A..T.D.I...M...VAG...K.....V.....VL.VC.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....I..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......A............K.........G............C...L...............E........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VV...RA.E.HM.Q.V..MKD.EA..II..C.N.....I...G..H...FD..NEI.D.....M..G.F.L.ENT...pGC..........T.K.IT.V.K.P......Q......VD...K.........W..........I........L........P......S........G.............K....S........LIVLAE..GRLVNLGCATG...........................................................................
SAHH_GEOSL/236-395               ..............................NIYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.IC.G.Y.G.E.............VGKGCAQ.AMR.GLQ.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....I...N....VI...TH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.A.L.KQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........S.............K....R........IILLAE..GRLVNLGCATG...........................................................................
SAHH_PSEMY/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spy........kngI.......N............D.........G............T...Essvd......aallgK........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.G.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........H........RtgagqfdpT......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
B3C7N8_9BACE/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............E.........A............C...T...............Q........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...pGI..........K.C.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
G0P174_CAEBE/193-354             ..............................NLYGIRESLP..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLK.AFG.S...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............L.......E............E.........A............A...P...............K........A.....N...I.....I.....V....T....T.....T....G....C....K...D....IV...TG.K.HF.E.L..LPN.DA..IV..C.N.....V...G..H...FD..CEI.D.....V..K.W.L.NAN....AT..........K.K.DT.I.K.P......Q......VD...R.........Y..........T........L........K......N........G.............R....H........VILLAE..GRLVNLGCATG...........................................................................
Q2LSQ9_SYNAS/279-441             ..............................NLYGCRESLA..DGI...K....R..A..T.D.I...M...VAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCVQ.SMR.GFG.A...R...V.I.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............T.............L.......E............D.........V............V...E...............E........G.....D...I.....F.....V....T....A.....T....G....C....C...D....VI...TG.E.HM.E.R..MKN.EA..IV..C.N.....I...G..H...FD..SEI.A.....M..H.Y.L.EGN...pAC..........K.K.ES.I.K.P......Q......VD...K.........W..........T........L........A......S........G.............R....S........IIMLAE..GRLVNLGCATG...........................................................................
B2FPC3_STRMK/239-401             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...L.....Y.....V....T....T.....T....G....N....K...D....II...RI.E.HL.S.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.VSF...aGI..........K.H.VN.I.K.P......Q......VD...K.........Y..........I........F........P......N........G.............N....A........IFLLAE..GRLVNLGCATG...........................................................................
G3W7X1_SARHA/268-429             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
G2GH70_9ACTO/243-405             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............T.............L.......D............E.........V............V...D...............K........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.S.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKI...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........E......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
G6HMM1_9ACTO/200-362             ..............................NRYGTGQSTL..DAI...F....R..A..T.N.T...L...LAG...K.....T.....VV.VA.G.Y.G.Y.............CGRGVAS.RAK.GMG.A...S...V.V.....V..T.....E...I..D.......P....T...K........A......L....D....A.........A...M....D......G.......F....R.....V.....L.............P.............M.......A............K.........A............A...A...............V........G.....D...V.....F.....I....T....V.....T....G....N....R...D....VI...RP.E.HF.E.L..MRD.GA..IL..A.N.....S...G..H...FD..VEI.D.....V..V.G.L.AAL....AT..........HgP.RR.V.R.P......S......TD...E.........Y..........V........L........A......D........G.............R....R........LLLLAE..GRLVNLGAAEG...........................................................................
Q66IP1_XENLA/279-440             ..............................NLYCCRESIL..DGL...K....R..S..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...V...V.H.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....E......G.......F....R.....V.....V.............K.............L.......S............E.........I............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...NR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.HTP....EL..........T.W.ER.I.R.S......Q......VD...H.........I..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-i..........................................................................
A6QNP1_BOVIN/35-196              ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
SAHH_MESSB/226-385               ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AI.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............E.........A............I...A...............T........A.....D...I.....I.....I....T....A.....T....G....N....K...D....VV...SL.D.HM.R.K..MKD.MV..IL..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNF....--..........K.W.VN.I.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........IILLSE..GRLLNLGNATG...........................................................................
C4XQV1_DESMR/234-396             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCAH.SMK.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...S...............Q........G.....D...I.....F.....V....T....A.....T....G....C....C...D....VI...TG.A.HM.E.K..MRD.GA..IV..C.N.....I...G..H...FD..SEI.A.....V..A.Y.L.ETT...pHC..........K.K.ES.I.K.P......L......VD...K.........W..........T........M........A......S........G.............N....A........ILMLAE..GRLVNLGCATG...........................................................................
D5EQ42_CORAD/233-399             ..............................NLYGCRESLL..DGI...K....R..A..T.D.V...M...VAG...K.....V.....GV.VC.G.Y.G.D.............VGKGCAA.ALK.GMG.A...Q...V.V.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....L.............T.............V.......E............D.........T............L...G...............W........G.....D...I.....Y.....V....T....T.....T....G....N....F...G....II...TA.D.AM.S.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.E.....V..D.K.L.YDM...pGV..........E.H.EE.I.K.P......Ddq..gaVD...K.........Y..........T........F........S......N........G.............N....S........IYLLAK..GRLVNLGCATG...........................................................................
F2RH42_STRVP/225-387             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......E............D.........V............V...E...............T........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.A.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AKI...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........E......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
Q2CJM8_9RHOB/222-381             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....I..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............L.............L.......E............D.........V............I...D...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.Q..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.N.L.RNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............T....R........IILLSE..GRLLNLGNATG...........................................................................
Q6PC06_DANRE/350-511             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCSA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......S............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...VR.E.YM.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
H2G757_CORDP/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............H.............V.......D............Q.........A............I...G...............D........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.A..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHR...dDV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............K....S........IVVLSE..GRLLNLGNATG...........................................................................
F8E0Z8_CORRG/210-376             ..............................NRYGTRHSLL..DGI...N....R..A..T.D.M...L...IGG...K.....N.....VL.VC.G.Y.G.D.............VGKGCAE.ALA.GQG.A...R...V.K.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............T.............V.......E............E.........A............I...S...............E........A.....D...I.....V.....I....T....A.....T....G....N....F...G....II...NF.E.HM.Q.N..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHH...dDV..........K.R.VN.I.K.P......Q......VD...E.........F..........T........F........P......Aan....ggE.............V....S........IVVLSE..GRLLNLGNATG...........................................................................
A2W5Y6_9BURK/234-393             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
G2FFT6_9GAMM/228-387             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLR.GLG.A...N...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............I.......E............D.........A............L...P...............V........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TH.D.HM.A.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.G.V.QKY....--..........E.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IIMLAE..GRLVNLGCATG...........................................................................
Q3SFY4_THIDA/267-432             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....I.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QT..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.V.EKY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........PpsadkpD........G.............K....R........IILLAK..GRLVNLGCATG...........................................................................
G3SHN5_GORGO/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....I...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........R........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
SAHH_MYCS2/244-405               ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....R.............T.............V.......E............E.........A............I...G...............E........A.....D...I.....V.....I....T....A.....T....G....N....K...D....II...TL.D.HM.K.A..MKN.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.A.L.ERS....GA..........K.K.IN.I.K.P......Q......VD...Q.........W..........I........F........D......D........G.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
H0K3P8_9PSEU/243-405             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.T...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............L.............L.......E............D.........V............V...E...............I........A.....D...I.....F.....V....T....T.....T....G....N....F...N....II...TA.E.HM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....V..A.G.L.EKI...pGI..........K.R.VE.I.K.P......Q......VD...E.........Y..........T........F........P......D........G.............H....S........IILLSK..GRLLNLGNATG...........................................................................
Q24LN1_PAVLU/134-295             ..............................NVYGCRHSLP..DGL...M....R..A..T.D.V...M...ISG...K.....K.....AC.IL.G.F.G.D.............VGKGCAQ.AMK.AAA.A...I...T.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....K......G.......F....Q.....V.....V.............T.............L.......E............E.........V............V...S...............I........I.....D...I.....F.....V....T....S.....T....G....N....K...D....II...ML.K.HM.Q.Q..MKN.NA..IV..S.N.....I...G..H...FD..NEI.D.....M..A.G.L.EKS....GA..........T.K.IN.I.K.P......Q......VD...A.........W..........R........F........A......S........G.............N....Q........IIVLAE..GRLMNLGCATG...........................................................................
C7XFD8_9PORP/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCSH.SMR.TYG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........A............V...K...............E........G.....N...I.....F.....V....T....T.....T....G....N....C...D....II...TI.E.HM.T.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.K.L.VNY...pNI..........K.H.TN.I.K.P......Q......VD...K.........Y..........T........F........P......N........G.............N....S........IFLLAE..GRLVNLGCATG...........................................................................
Q1NYG3_9DELT/196-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....I.....CV.VA.G.Y.G.D.............VGKGSAQ.AFR.GMG.A...T...V.W.....V..T.....E...C..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....R.....I.....V.............T.............M.......D............D.........A............A...A...............K........A.....D...I.....F.....V....T....A.....T....G....N....I...N....VI...TR.G.HM.E.K..MRD.QA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.A.L.KDL....--..........E.W.DN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............H....R........IILLAE..GRLVNLGCATG...........................................................................
G3LPE2_9BRAS/1-124               ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.AMK.TAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.T.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tK.............T....G........IIVLAE..GRLMNLGCATG...........................................................................
F6SNC6_CIOIN/223-384             ..............................NLYSCRESVL..DGL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCS.ALK.GLG.S...V...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......I....R.....V.....V.............R.............F.......H............E.........V............V...K...............T........A.....D...I.....F.....I....T....C.....S....G....N....K...N....VI...TR.D.SL.D.K..MKN.GA..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.KTN....DL..........T.W.EK.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
A5PMG3_DANRE/259-420             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCS.ALK.ALG.A...I...V.C.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............V...R...............Q........M.....D...M.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VILLAE..GRLLNLSCST-v..........................................................................
I1K3S4_SOYBN/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.K.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ENY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tN.............V....G........IIVLAE..GRLMNLGCATG...........................................................................
F8PK80_SERL3/189-350             ..............................NYYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAE.SLR.SYG.A...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....E.....V.....T.............T.............M.......D............D.........A............A...Y...............R........S.....N...V.....F.....V....T....T.....T....G....N....R...D....II...TA.Q.HF.N.A..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AV..........Q.A.VN.V.K.P......Q......VD...R.........F..........T........M........A......S........G.............R....H........IILLAE..GRLVNLGH---vis........................................................................
H6NG88_9BACL/189-350             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...V...VAG...K.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.I.....V..T.....E...I..D.......A....I...K........G......V....E....A.........Y...M....D......G.......F....A.....V.....M.............P.............M.......S............E.........A............A...K...............V........G.....D...F.....F.....V....T....V.....T....G....N....R...D....VI...RG.E.HY.E.V..MKD.GA..IL..S.N.....A...G..H...FD..VEV.N.....K..P.E.L.EAL....SV..........S.K.RT.V.R.R......N......IE...E.........Y..........S........L........K......D........G.............R....K........FYILAE..GRLVNLAAG--dg.........................................................................
B4IBP7_DROSE/252-413             .............................t-FYTCRDSIL..DSL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.D.............VGKGCAQ.SLK.GQG.C...I...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....R.....V.....V.............R.............L.......N............E.........V............I...K...............T........V.....D...V.....V.....V....T....A.....T....G....N....K...N....VI...TR.D.HM.N.R..MKN.GC..IL..C.N.....M...G..H...SC..SEI.D.....V..N.G.L.HTP....EL..........T.W.ER.V.R.S......Q......VD...H.........I..........R........W........P......D........G.............R....M........IILLAE..GRLVNLSCST-i..........................................................................
D5EA49_METMS/228-390             ..............................NVYGCRESLV..DAI...K....R..G..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.ALA.NHK.A...R...V.I.....I..T.....E...T..D.......P....I...C........A......L....Q....A.........L...M....E......G.......Y....D.....V.....M.............T.............V.......E............D.........A............L...P...............Y........G.....D...I.....Y.....V....T....T.....T....G....N....C...D....VL...TT.E.HM.S.N..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NKM...dNV..........K.K.VN.I.K.P......Q......VD...E.........Y..........Q........F........P......D........G.............H....S........IYVLAE..GRLVNLGLATG...........................................................................
Q5CBL5_9THEM/174-335             ..............................NRYGTGQSTW..DAI...M....R..N..T.N.L...L...VAG...K.....N.....VV.VA.G.Y.G.W.............CGRGIAL.RAA.GLG.A...R...V.I.....V..T.....E...V..D.......P....I...K........A......V....E....A.........I...M....D......G.......F....T.....V.....M.............P.............M.......K............E.........A............V...K...............I........A.....D...F.....L.....V....T....A.....T....G....N....T...D....VL...SK.E.DI.L.S..LKD.GA..VL..A.N.....A...G..H...FN..VEI.P.....V..R.V.L.EEI....AV..........E.K.FE.A.R.P......N......VT...G.........Y..........T........L........E......N........G.............K....T........VFLLAE..GRLVNLAAG--dg.........................................................................
G4SUH2_META2/191-350             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VC.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............L.......E............D.........A............A...P...............I........A.....N...I.....F.....V....T....A.....T....G....N....F...N....VI...TH.D.HM.A.A..MRD.QA..IV..C.N.....I...G..H...FD..SEI.E.....I..S.S.L.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........LIVLAE..GRLVNLGCATG...........................................................................
A9A2E9_NITMS/184-345             ..............................NRYGTGQSTI..DGY...L....R..A..M.N.L...L...MAS...K.....R.....VV.VV.G.Y.G.W.............VGRGVAA.RCH.GMG.S...K...V.I.....V..T.....E...I..D.......P....V...K........A......L....E....A.........H...M....D......G.......F....E.....V.....M.............P.............M.......A............Q.........A............T...K...............L........G.....D...I.....F.....I....T....C.....T....G....M....T...S....VI...RK.E.HI.L.K..MKD.GA..IM..G.N.....V...G..H...FD..VEI.D.....S..E.F.L.LKK....SK..........S.V.KE.V.R.P......A......LD...E.........C..........V........L........K......N........G.............K....K........VYLIGQ..GRLANLVAAE-g..........................................................................
H0X841_OTOGA/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
D5Z893_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
D4Z1N5_SPHJU/230-389             ..............................NLYGCKESLV..DAI...R....R..A..T.D.V...M...LAG...K.....V.....AC.VA.G.F.G.D.............VGKGSAA.SLR.NGG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............E.........A............A...T...............R........A.....D...I.....F.....V....T....A.....T....G....N....E...A....VI...TV.D.HM.R.A..MKN.MA..IV..C.N.....I...G..H...FD..SEI.E.....I..A.G.L.NNM....--..........Q.W.TE.I.K.P......Q......VD...E.........V..........Q........F........P......D........G.............K....K........IIVLAK..GRLVNLGCATG...........................................................................
D4T7X9_9XANT/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KAL...kDV..........Q.K.IN.I.K.P......Q......VD...K.........Y..........V........F........P......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
D3LUW8_9FIRM/184-345             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.L...T...VVG...K.....K.....VV.IA.G.Y.G.W.............CGRGCAM.RAK.GLG.A...H...V.I.....V..T.....E...V..D.......P....I...K........A......I....E....A.........V...F....D......G.......F....E.....V.....M.............P.............M.......A............E.........A............A...K...............A........G.....D...I.....F.....V....T....L.....T....G....D....K...D....VI...RG.E.HM.K.H..MKD.GV..IL..A.N.....A...G..H...FD..VEI.N.....K..V.E.L.EAL....AV..........R.K.FE.A.R.H......N......IE...G.........Y..........E........L........P......N........G.............H....R........INLLAE..GRLVNLAAG--dg.........................................................................
G8NK06_BRUSS/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
B2Q516_PROST/188-349             ..............................NRYGVGSSVV..ESI...A....H..A..T.N.V...M...IHG...K.....K.....VV.VI.G.Y.G.Y.............CGSGVAQ.RFR.GMG.A...H...V.T.....V..V.....D...T..N.......P....L...T........R......L....E....A.........H...L....E......G.......F....Q.....T.....A.............E.............L.......L............D.........T............L...C...............D........A.....D...F.....V.....V....S....V.....V....G....R....D...N....IL...TS.K.HF.T.A..MKD.NV..IV..A.N.....A...G..H...FQ..REV.D.....I..K.A.L.NSI....TS..........S.C.ED.V.T.P......N......IN...R.........Y..........Q........L........K......T........G.............K....N........IFLMSD..ANLVNLSAGN-g..........................................................................
B9J9W2_AGRRK/171-334             ..............................NKHGVGQSLF..ESY...L....R..F..T.N.R...S...TNG...K.....R.....VA.VF.G.Y.G.A.............CGKGTAA.CFR.NAF.S...A...V.S.....V..V.....D...I..D.......P....V...T........T......L....E....A.........H...L....D......G.......F....G.....T.....P.............L.............R.......D............E.........G............I...R...............S........A.....D...I.....L.....I....T....V.....T....G....Y....P...A....II...TA.T.DL.P.L..IKD.GA..IL..M.N.....G...G..H...FP..LEI.D.....V..E.A.F.RNSpevaGV..........D.R.YE.V.-.E......H......IE...T.........I..........R........M........R......D........G.............R....A........FHILGA..GHMANLA----gpr........................................................................
A7NFR5_ROSCS/187-348             ..............................NRYGTGQSTL..DGI...L....R..A..T.N.V...L...LAG...K.....T.....FV.VG.G.Y.G.Y.............CSRGIAE.RAR.GMG.A...N...V.I.....V..T.....E...V..N.......P....I...R........A......L....E....A.........A...M....D......G.......Y....R.....V.....M.............P.............M.......R............E.........A............V...K...............V........A.....D...F.....V.....V....T....A.....T....G....N....K...N....VL...DA.E.DF.A.V..MKD.GC..IV..A.N.....S...G..H...FN..VEI.N.....I..P.D.L.EAL....SV..........E.K.RQ.P.R.A......F......VD...Q.........Y..........I........L........K......D........G.............R....R........INLLGE..GRLINLASAE-g..........................................................................
H3DCE5_TETNG/314-476             ..............................NLYCCRESIL..DGL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCT.ALK.ALG.A...I...V.C.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....K.....V.....V.............K.............L.......S............E.........V............I...R...............Q........M.....D...V.....V.....I....T....C.....T....G...gN....K...N....VV...TR.E.QL.D.R..MKN.GC..IV..C.N.....M...G..H...YN..TEI.D.....V..A.S.L.RSP....EL..........T.W.ER.V.R.S......Q......VD...H.........I..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
A3TXW8_9RHOB/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.I.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......E............E.........V............V...G...............M........A.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.N.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
G4FH86_THEMA/174-335             ..............................NRYGTGQSTW..DAI...M....R..N..T.N.L...L...VAG...K.....N.....VV.VA.G.Y.G.W.............CGRGIAL.RAA.GLG.A...R...V.I.....V..T.....E...V..D.......P....V...K........A......V....E....A.........I...M....D......G.......F....T.....V.....M.............P.............M.......K............E.........A............V...K...............I........A.....D...F.....V.....I....T....A.....S....G....N....T...D....VL...SK.E.DI.L.S..LKD.GA..VL..A.N.....A...G..H...FN..VEI.P.....V..R.V.L.EEI....AV..........E.K.FE.A.R.P......N......VT...G.........Y..........T........L........E......N........G.............K....T........VFLLAE..GRLVNLAAG--dg.........................................................................
B8LLP3_PICSI/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCSA.ALK.VAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....P.....V.....L.............T.............L.......E............D.........V............V...S...............T........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...ML.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..Q.G.L.ETF...pGV..........K.K.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
F6W2S1_ORNAN/191-352             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
Q5WV19_LEGPL/202-361             ..............................NLYGCRESLL..DGL...K....R..A..T.D.V...M...IAG...K.....V.....AL.IL.G.Y.G.D.............VGKGCAQ.ALR.GQG.A...T...V.L.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............L.......D............D.........V............A...E...............Q........V.....D...I.....V.....V....T....A.....T....G....N....Y...H....VV...TH.D.HM.K.R..MRN.QA..IL..C.N.....I...G..H...FD..SEI.D.....I..Q.S.L.KQY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IIILAE..GRLVNLGCATG...........................................................................
G2PM46_MURRD/197-358             ..............................NKYGCRESAV..DAI...R....R..A..T.D.T...M...LAG...K.....R.....VV.VA.G.Y.G.D.............VGKGTAA.SFR.GAG.A...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....E.....V.....K.............K.............L.......E............T.........V............V...S...............N........A.....D...I.....V.....I....T....T.....T....G....N....K...D....II...RE.E.HF.R.A..LKD.KA..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NGT...yGD..........T.K.DE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........LIILAE..GRLVNLGCATG...........................................................................
B9GFJ3_POPTR/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.AMK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............I...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETF...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
F8LV50_STRTR/347-494             .......................fgtdyil----------..---...-....H..Q..K.N.L...L...MQY...M.....Q.....VV.CI.G.Y.G.K.............IGYGICT.KLR.ELG.I...R...P.K.....V..L.....E...K..D.......S....M...R........T......I....Q....A.........V...R....D......G.......C....D.....I.....L.............-.............L.......E............K.........D............F...K...............N........I.....D...L.....I.....F....C....A.....T....G....S....K...S....L-...DI.L.DF.R.S..IKD.GT..FL..V.S.....A...T..S...SD..DEF.N.....Y..S.Y.L.LDE....YE..........E.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------ivetslitryesednyfyllnqgtptnfvv.............................................
H1WJF3_9CYAN/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.V...L...LAG...K.....N.....VV.VV.G.Y.G.W.............CGKGSAL.RAR.GLG.A...N...V.I.....V..T.....E...V..D.......P....V...R........A......I....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......E............Q.........A............A...S...............L........G.....D...L.....F.....I....T....V.....T....G....N....K...H....VI...RG.E.HF.D.V..MKD.GA..MV..C.N.....S...G..H...FD..IEI.D.....L..K.D.L.AER....ST..........E.I.KE.V.R.N......F......TQ...Q.........Y..........K........L........K......N........G.............K....S........VVVLGE..GRLINLAAAE-g..........................................................................
B3MR98_DROAN/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....CC.VA.G.Y.G.D.............VGKGCAQ.ALK.GFG.G...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............S...K...............E........A.....S...I.....F.....V....T....T.....T....G....C....R...D....II...TG.Q.HL.L.Q..MPD.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..D.W.L.NAN....AK..........E.K.VN.V.K.P......Q......VD...R.........Y..........T........M........A......N........G.............K....H........IILLAE..GRLVNLGCAHG...........................................................................
D6JUI6_ACIG3/198-373             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VV.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
I0V6F2_9PSEU/246-408             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.T...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....T.............V.............L.......E............D.........V............V...E...............I........A.....D...I.....F.....V....T....T.....T....G....N....F...N....II...TA.E.HM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....V..A.G.L.EKT...pGI..........K.H.VE.I.K.P......Q......VD...E.........Y..........V........F........P......D........G.............H....S........IILLSR..GRLLNLGNATG...........................................................................
H0RF67_9ACTO/251-412             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............D.........A............I...S...............G........A.....D...I.....V.....I....T....S.....T....G....N....K...D....II...LL.E.HM.K.Q..MKN.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........K.R.IN.V.K.P......Q......VD...Q.........W..........I........F........D......D........G.............H....S........IIVLSE..GRLLNLGNATG...........................................................................
B4ILS9_DROSE/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....CC.VA.G.Y.G.D.............VGKGCAQ.ALK.GFG.G...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............S...K...............E........A.....S...I.....F.....V....T....T.....T....G....C....R...D....II...TS.V.HL.Q.Q..MPD.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..D.W.L.NAN....AK..........E.K.VN.V.K.P......Q......VD...R.........Y..........T........M........Q......S........G.............K....H........IILLAE..GRLVNLGCAHG...........................................................................
C5ASM2_METEA/229-388             ..............................NLYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.G.L.KNL....--..........K.W.QN.I.K.P......Q......VD...E.........I..........E........F........A......D........G.............H....R........IILLSE..GRLVNLGNATG...........................................................................
A3ERN9_9BACT/185-346             ..............................NRYGTGQSTL..DGI...M....R..A..T.N.R...L...FAG...S.....T.....VV.VA.G.Y.G.W.............CGRGIAR.RAQ.GLG.A...R...V.I.....V..T.....E...I..D.......P....V...K........A......L....E....A.........V...M....D......G.......F....H.....V.....M.............P.............M.......V............K.........A............A...P...............L........G.....D...F.....F.....I....T....V.....T....G....N....I...H....VV...GS.D.AF.D.V..MKD.GA..IV..C.N.....S...G..H...FN..VEI.N.....I..P.Y.L.ESI....SV..........S.K.SV.L.R.D......F......VE...E.........Y..........V........T........R......D........G.............R....K........IMVLGE..GRLINLAAAE-g..........................................................................
F7S8D6_9PROT/195-354             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.F.G.D.............VGKGSAA.SLR.NAG.C...R...V.M.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......D............D.........A............A...P...............K........G.....D...I.....F.....V....T....A.....T....G....N....I...D....VI...TA.D.HM.R.A..MKH.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..E.S.L.RNY....--..........K.W.EN.V.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
F3ZQU7_9BACE/232-394             ..............................NFYSCKGTIA..ESI...K....K..A..T.R.T...M...LIG...K.....D.....VV.IC.G.F.G.D.............IGRGCAE.ALR.NSG.A...R...V.S.....I..T.....E...T..D.......P....I...R........A......M....G....A.........A...M....E......G.......Y....Q.....V.....V.............K.............L.......N............D.........V............C...E...............T........A.....D...I.....F.....I....T....A.....T....G....R....K...H....IL...KF.E.HM.Q.R..MKD.QA..II..C.N.....M...G..H...YE..LEI.E.....Y..D.V.L.NTH...pEI..........K.K.IP.I.S.P......Q......LK...R.........Y..........F........F........P......D........G.............N....S........ILLIAE..GKLVNLACDT-t..........................................................................
D6TJE1_9CHLR/189-350             ..............................NRYGTGQSTL..DAI...I....R..S..T.N.R...L...LAG...R.....T.....LV.VF.G.Y.G.W.............CGRGVAS.RGH.GLG.A...N...V.V.....V..C.....E...V..D.......P....T...R........A......L....E....A.........V...M....D......G.......Y....R.....V.....M.............P.............G.......V............E.........A............A...A...............I........G.....D...I.....L.....V....T....V.....T....G....D....I...N....VI...DQ.D.HL.E.H..MKN.GV..LI..A.N.....S...G..H...FN..DEI.N.....I..P.A.L.EKL....AT..........N.K.RR.V.R.D......F......VD...E.........Y..........T........Y........S......D........G.............R....R........VYLLAE..GRLVNLSAAEG...........................................................................
B5YHE1_THEYD/186-347             ..............................NRYGTGQSTI..DGI...L....R..A..T.N.R...L...LAG...S.....I.....FV.VC.G.Y.G.W.............CGRGVAM.RAK.GMG.A...R...V.V.....V..T.....E...V..D.......P....L...K........A......L....E....A.........V...M....D......G.......F....D.....V.....M.............P.............I.......I............D.........A............A...K...............I........G.....D...I.....F.....V....T....V.....T....G....N....I...N....VI...SE.N.VF.S.K..MKN.GA..IV..A.N.....T...G..H...FN..VEI.D.....I..E.G.L.NKL....SK..........S.K.RV.I.R.E......F......VE...E.........Y..........T........L........K......D........G.............R....R........IYLLAE..GRLVNLSAAEG...........................................................................
Q6FWX3_CANGA/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAA.SLR.GMG.A...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............D.........A............A...S...............V........G.....Q...V.....F.....V....T....T.....T....G....C....R...D....II...KG.E.HF.E.K..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KEN....AK..........E.C.IN.I.K.P......Q......VD...R.........Y..........L........L........S......S........G.............R....H........VILLAN..GRLVNLGCATG...........................................................................
E2REN1_CANFA/163-324             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
D2SFJ4_GEOOG/250-412             ..............................NLYGCRHSLV..DGL...N....R..A..T.D.V...M...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.ALR.GQG.A...R...V.V.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....S.............T.............L.......D............D.........V............I...D...............Q........A.....D...I.....I.....V....T....A.....T....G....N....R...D....VI...TA.E.QL.G.R..TKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ART...pGI..........T.R.TN.I.K.P......Q......VD...E.........W..........R........F........A......D........G.............H....T........IIVLSE..GRLLNLGNATG...........................................................................
F4WQS6_ACREC/287-448             ..............................NLYSCRESII..DSL...K....R..S..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.E.............VGKGCCQ.ALK.GLG.C...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....R.....V.....M.............K.............L.......N............E.........V............I...R...............N........V.....D...I.....V.....I....T....A.....T....G....N....K...N....VV...TR.E.HM.D.K..MKN.GC..VV..C.N.....M...G..H...SN..TEI.D.....V..N.S.L.RTP....DL..........T.W.EK.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLVNLSCSS-i..........................................................................
Q753T3_ASHGO/194-355             ..............................NLYGCRESLV..DGL...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAA.ALR.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....T.............T.............M.......D............Q.........C............A...S...............Y........G.....Q...V.....F.....V....T....T.....T....G....C....R...D....II...KK.E.HF.L.A..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AV..........E.A.VN.I.K.P......Q......VD...R.........Y..........L........L........S......S........G.............R....H........VILLAD..GRLVNLGCATG...........................................................................
F3WUH8_9SPHN/233-392             ..............................NLYGCKESLV..DAI...R....R..A..T.D.V...M...LAG...K.....V.....AA.VA.G.F.G.D.............VGKGSAQ.SLR.NGG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......D............E.........A............V...K...............R........A.....D...I.....F.....V....T....A.....T....G....N....A...D....VI...TA.D.HM.K.A..MKP.MS..IV..C.N.....I...G..H...FD..SEI.Q.....I..A.A.L.SNY....--..........K.W.TE.V.K.P......G......TD...L.........V..........E........F........P......D........G.............K....Q........IIVLAK..GRLVNLGCATG...........................................................................
E0DD48_9CORY/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............T.............V.......D............T.........A............I...R...............D........A.....D...L.....V.....I....T....A.....T....G....N....L...G....II...TF.E.QM.L.E..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHR...dDV..........T.R.VN.I.K.P......Q......VD...E.........F..........H........L........P......N........G.............R....A........IIVLSE..GRLLNLGNATG...........................................................................
F4QAM4_DICFS/194-354             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....I.....SV.VA.G.Y.G.D.............VGKGCAQ.SLS.KMG.S...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........C...M....D......G.......Y....Q.....I.....V.............T.............M.......E............E.........A............A...S...............Q........A.....N...I.....F.....V....T....T.....T....G....C....R...D....II...TA.R.HF.E.E..MKE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.NAN....-A..........T.K.IN.I.K.P......Q......VD...R.........Y..........T........M........K......N........G.............R....H........ILLLAE..GRLVNLGCATG...........................................................................
G1V277_9DELT/235-397             ..............................NLYGCRESLA..DGI...K....R..A..T.D.I...M...IAG...K.....V.....VV.IA.G.Y.G.D.............VGKGCAH.SMR.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............D.........A............V...K...............E........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TG.E.HM.N.N..MKD.EA..IV..C.N.....I...G..H...FD..NEI.E.....M..T.W.L.EEN...pAN..........K.R.IQ.I.K.P......Q......VD...K.........W..........V........L........P......N........G.............R....S........LIILAE..GRLVNLGCATG...........................................................................
G3Q588_GASAC/362-523             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...VR.E.YL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
F8WGT1_MOUSE/371-532             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
SAHH_TOBAC/240-403               ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............D........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
Q5CI16_CRYHO/244-407             ..............................NTYGCRQSLL..HGL...F....N..G..C.I.Q...M...LAG...K.....K.....IV.VL.G.Y.G.E.............VGKGCAQ.GLS.GVG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....Q.....V.....S.............V.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....I....T....A.....T....G....N....K...D....VI...TV.E.HM.R.K..MKE.NA..YI..A.N.....I...G..H...FD..DEI.D.....V..Y.G.L.ENY...pGI..........K.V.IE.V.K.Q......N......VH...K.........F..........T........F........P......D.......tQ.............K....S........VILLCK..GRLVNLGCATG...........................................................................
A8LCE0_FRASN/236-398             ..............................NKYGCRHSVI..DGL...N....R..A..T.D.V...L...IGG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAD.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....A.............T.............L.......E............D.........V............V...S...............T........A.....D...I.....F.....V....T....T.....T....G....N....Y...D....II...TA.A.HM.A.A..MKH.QA..IV..S.N.....I...G..H...FD..NEI.D.....M..A.G.L.TKT...pGI..........E.K.IN.I.K.P......Q......VD...E.........W..........V........F........P......D........G.............H....S........IIVLAE..GRLMNLGCATG...........................................................................
G0I5B7_CORPS/237-399             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............T.............V.......D............Q.........A............I...S...............E........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.K..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.LlHRN....DV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............N....A........IIVLSE..GRLLNLGNATG...........................................................................
E4R9D1_PSEPB/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............Spf........idgI.......N............Dgt.....eaS............I...Dka..........llgK........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........H........RtgagsfdpQ......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
SAHH_BURP0/234-393               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
G3R806_GORGO/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
D8KA87_NITWC/198-357             ..............................NLYGCRESLL..DGI...K....R..A..T.D.V...M...IAG...K.....I.....TV.IL.G.Y.G.D.............VGKGCAQ.SLR.GQG.A...T...V.W.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............E.........A............A...G...............K........G.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TF.E.HM.Q.A..MKN.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.EQY....--..........P.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
SAHH_GLOVI/194-355               ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....IV.VA.G.Y.G.W.............CGKGVAL.RAR.GMG.A...N...V.V.....V..T.....E...I..N.......P....V...R........A......I....E....A.........A...M....D......G.......L....Q.....V.....M.............P.............M.......A............E.........A............A...C...............L........G.....D...L.....F.....I....T....V.....T....G....N....K...H....VI...RR.E.HF.A.M..MKD.GA..IV..C.N.....S...G..H...FD..IEI.D.....L..V.A.L.GEL....SS..........E.R.RM.V.R.P......F......TE...E.........Y..........T........L........E......G........G.............K....S........VIVLGE..GRLINLAAAE-g..........................................................................
F6SIF5_MONDO/331-492             ..............................NLYCCRESIL..DGL...K....K..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...I....D......G.......F....Q.....L.....V.............K.............L.......N............G.........V............I...W...............Q........V.....D...I.....V.....T....T....C.....T....G....N....K...N....VV...TR.E.HL.G.H..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.HTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........T......D........G.............K....R........IVLLAE..GHLLNLSCST-v..........................................................................
D5YJL6_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
G5ZXB9_9PROT/225-384             ..............................NLYGCRESLV..DGI...R....R..A..T.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.QGG.A...R...V.M.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............Q.........A............A...E...............K........A.....D...I.....F.....V....T....A.....T....G....N....K...D....VI...TL.D.HM.R.E..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..S.S.L.SNM....--..........T.W.RE.V.K.P......Q......VD...E.........I..........E........F........P......D........G.............K....R........MILLAK..GRLVNLGCATG...........................................................................
A7XB43_ARATH/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.IC.G.Y.G.D.............VGKGCAA.AMK.TAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........M...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..Q.G.L.ETF...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tK.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
F2LHI6_BURGS/233-392             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....F...H....VI...GH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....I..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
D5XYR8_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
SAHH_PSEU2/199-381               ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidgendgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DS.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgpgsfdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
E3E8G6_PAEPS/190-351             ..............................NRYGTGQSAF..DGI...I....R..T..T.N.L...V...VAG...S.....T.....VV.VV.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.V.....V..T.....E...V..D.......P....I...K........A......V....E....A.........H...M....D......G.......F....H.....V.....L.............P.............M.......V............E.........A............A...K...............L........G.....D...F.....F.....I....T....V.....T....G....N....K...A....VI...TG.E.HF.D.V..MKD.GA..VL..C.N.....A...G..H...FD..VEV.S.....K..P.E.L.AKR....SE..........S.I.RT.V.R.R......N......IE...E.........Y..........R........F........K......D........G.............R....K........MYLLAE..GRLVNLAAAD-g..........................................................................
G7N511_MACMU/191-354             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....P....T.....T....G....C....V...D....II...LG.R.HF.E.Q..MKD.DA..IL.pC.A.....G...G..C...FG..AVR.E.....C..L.M.G.TVG....GR..........E.A.CQ.T.R.G.....wA......VD...R.........Y..........R........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
G0HNQ3_THES4/188-349             ..............................NRYGTGQSTW..DGI...L....R..T..T.N.L...L...IAG...K.....N.....VV.VV.G.Y.G.W.............CGRGIAM.RAR.GLG.A...T...V.I.....V..V.....E...V..D.......P....I...R........A......L....E....A.........R...M....D......G.......F....L.....V.....M.............N.............M.......M............E.........A............A...K...............V........G.....D...I.....F.....I....T....S.....T....G....D....I...N....CI...RR.E.HF.E.V..MKD.GV..IM..A.N.....A...G..H...FD..VEI.S.....K..P.D.L.EEL....AV..........E.I.SE.P.R.P......N......IT...E.........Y..........R........M........A......D........G.............R....R........LYLLAE..GRLVNLAAAD-g..........................................................................
G6IFN6_9DELT/240-402             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...LAG...K.....T.....VV.VA.G.Y.G.D.............VGKGCAA.SMK.GYG.A...I...V.L.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......D............Q.........A............V...T...............R........G.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TG.E.HI.A.Q..MKD.ES..II..C.N.....I...G..H...FD..SEI.E.....M..S.F.L.DNH...pNA..........E.K.IT.I.K.P......Q......VD...K.........W..........I........L........P......S........G.............R....S........VIVLAE..GRLVNLGCATG...........................................................................
C8PZZ4_9GAMM/205-378             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.M...L...LAG...R.....R.....AL.VV.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...V...V.R.....V..T.....E...A..D.......P....I...C........G......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............Spfveg...dpakgV......nN............T.........L............M...Q...............D........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...NS.D.ML.K.A..LKA.TA..VV..C.N.....I...G..H...FD..TEI.D.....T..Q.F.M.RDN....-W..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............D....Y........LLLLSE..GRLVNLGNATG...........................................................................
B6T440_MAIZE/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............P.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tN.............T....G........IIVLAE..GRLMNLGCATG...........................................................................
E8LD00_9FIRM/184-346             ..............................NRYGTGQSSW..DGI...M....R..T..T.N.M...S...VAG...R.....T.....VV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.I.....V..T.....E...V..D.......P....I...K........G......I....E....A.........V...F....D......G.......F....R.....V.....M.............P.............M.......Q............E.........A............A...K...............H........G.....D...I.....F.....V....T....V.....T....G....C....K...D....VI...TK.P.HM.E.V..MKN.GA..VM..C.N.....A...G..H...FD..VEI.N.....K..H.H.L.EEL...sVV..........A.P.YE.V.R.K......N......IM...T.........Y..........T........M........A......D........G.............R....K........LNLLGE..GRLVNLACGD-g..........................................................................
F7GT77_MACMU/191-354             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....V...D....II...LG.R.HF.E.Q..MKD.DA..IV.pC.A.....G...G..C...FG..AVR.E.....C..L.M.G.TVG....GR..........E.A.CQ.T.R.G.....wA......VD...R.........Y..........R........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
E9ETM7_METAR/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALH.GMG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....Q.....V.....T.............T.............M.......E............K.........A............A...K...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.E.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AA..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........K......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
F6WEW4_MOUSE/4-108               ............................sw----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......V....Q....S.........P...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
SAHH_CHLP8/231-393               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VL.G.Y.G.D.............VGKGCAH.SMR.SYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....Q.....V.....T.............T.............I.......E............E.........A............L...E...............E........G.....N...I.....Y.....V....T....T.....T....G....N....K...D....VI...TL.E.HM.K.K..MKD.EA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NNF...kGA..........T.R.IN.I.K.P......Q......VD...K.........Y..........V........F........E......D........G.............R....C........IYLLAE..GRLVNLGCATG...........................................................................
A1RRW2_PYRIL/210-372             ..............................NRYGTGQSTW..DGV...L....R..A..T.N.L...L...IAG...K.....N.....VV.IA.G.Y.G.W.............VGRGIAM.RAR.GLG.A...R..rV.I.....V..V.....E...V..D.......P....V...R........A......L....E....A.........V...F....D......G.......F....E.....V.....M.............P.............M.......D............K.........A............A...E...............I........G.....D...I.....F.....I....T....A.....T....G....N....I...R....AI...NL.G.HI.F.K..MKD.GA..VL..A.N.....A...G..H...FN..VEI.D.....V..A.G.L.ERV....AI..........S.K.KL.I.R.Q......Y......LE...E.........Y..........T........L........P......N........G.............K....R........VYLIGE..GRLVNLVAAE-g..........................................................................
C5C9B9_MICLC/265-431             ..............................NKYGIRHSLP..DGI...M....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGAAE.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............R.............L.......E............D.........V............V...G...............E........G.....D...I.....F.....V....T....T.....T....G....G....K...D....II...MA.E.HM.A.A..MKD.KA..IV..G.N.....V...G..H...FD..NEI.D.....M..A.G.L.ARI...pGV..........V.K.TE.I.K.P......Q......VH...E.........W..........T........L........D......G........Gte.........aeR....S........IIVLSE..GRLLNLGNATG...........................................................................
SAHH_PROM2/233-392               ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...IAG...K.....V.....AL.VI.G.F.G.D.............VGKGSAQ.SLR.GLG.A...I...V.K.....V..A.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....S.....V.....V.............R.............L.......E............D.........V............V...E...............D........I.....D...I.....F.....V....T....A.....T....G....N....Y...Q....VI...TK.E.NL.V.K..MKN.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KNY....--..........P.W.EN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....K........IILLAE..GRLVNLGCATG...........................................................................
B8G010_DESHD/196-357             ..............................NRYGTGQSVW..DGI...M....R..T..T.N.L...V...VAG...K.....T.....IC.VV.G.Y.G.W.............CGKGVAL.RAK.GLG.A...R...V.I.....I..C.....E...V..N.......P....I...K........A......N....E....A.........W...M....D......G.......F....E.....V.....M.............P.............M.......L............A.........A............A...P...............L........G.....D...F.....F.....V....T....V.....T....G....N....K...N....VI...SG.E.HF.Q.V..MKD.GA..IL..A.N.....A...G..H...FD..VEV.N.....K..V.Q.L.AAM....AQ..........S.C.HE.V.R.R......N......IE...E.........Y..........L........L........Q......D........G.............R....K........IYLLAE..GRLVNLAAG--dg.........................................................................
Q5EN86_AURAU/1-122               ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............------Q.ALR.GFG.A...R...V.I.....V..S.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....E.....V.....A.............T.............I.......D............D.........V............I...E...............K........A.....Q...I.....F.....V....T....A.....T....G....C....K...D....II...TG.K.HF.A.Q..MRE.DA..IV..C.N.....I...G..H...FD..CEL.D.....V..K.W.L.NDN....-C..........K.K.DT.I.K.P......Q......VD...R.........Y..........T........L........P......N........G.............R....H........IILLAE..GRLVNLGCAHG...........................................................................
H3LQF9_KLEOX/177-326             .........................whtff----------..---...-....Q..T..T.H.L...T...LHE...K.....K.....VL.VI.G.Y.G.L.............VGQGVAA.AAK.AFG.G...Q...V.M.....V..A.....E...I..D.......P....A...R........R......L....Q....A.........A...Y....D......G.......W....H.....V.....V.............E.............L.......Q............E.........A............I...A...............S........A.....D...V.....V.....A....T....A.....T....G....G....K...K....VV...NS.Q.AL.D.K..CKD.GV..FI..L.N.....V...G..H...VA..EEI.D.....C..E.Y.L.RQF....--..........S.H.EE.V.M.P......Y......IN...A.........Y..........R........M........G......Q........-.............K....T........IYLMAN..GSMLNLTAG--fg.........................................................................
F0VM57_NEOCL/232-395             ..............................NVYGCRHSLP..DGI...M....R..A..T.D.V...M...LGG...K.....R.....VV.IC.G.F.G.D.............VGKGCAA.AMK.GAG.A...R...V.V.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....S.....V.....V.............T.............L.......E............S.........Q............L...A...............V........G.....D...I.....F.....I....S....A.....T....G....N....K...D....II...TA.K.HM.S.Q..MKN.NA..IV..G.N.....I...G..H...FD..NEV.D.....M..A.G.L.TSW...pGI..........K.K.IN.I.K.P......Q......VD...R.........F..........V........F........P......E.......dD.............H....G........VIVLAE..GRLLNLGCATG...........................................................................
G0CNN1_CORUL/237-399             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....S.....V.....V.............T.............V.......D............Q.........A............I...S...............E........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.D.HM.L.K..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.LlHRN....DV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............N....A........IIVLSE..GRLLNLGNATG...........................................................................
H2JG32_9CLOT/184-345             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...I...VAG...K.....N.....VV.VA.G.Y.G.W.............CGKGIAM.RAK.GFG.A...S...V.I.....V..T.....E...V..D.......P....I...K........A......A....E....A.........V...M....D......G.......F....K.....V.....M.............K.............M.......S............D.........A............A...K...............V........G.....D...F.....F.....I....T....V.....T....G....C....R...D....VI...KA.E.HF.N.L..MKD.GA..IL..C.N.....A...G..H...FD..VEV.S.....V..E.E.L.EKI....AV..........E.K.QI.Q.R.H......N......IT...G.........Y..........K........M........E......N........G.............R....W........INLLAE..GRLVNLAAG--dg.........................................................................
D6FRF0_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
B8LLL7_PICSI/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.VAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....P.....V.....L.............T.............L.......E............D.........V............V...S...............T........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...ML.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..Q.G.L.ETF...pGV..........K.K.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
SAHH_BACTN/236-398               ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............D.........A............C...T...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...sGI..........K.C.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........ILLLAD..GRLVNLGCATG...........................................................................
A3PG19_RHOS1/224-383             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...Q...............D........A.....D...I.....F.....I....T....T.....T....G....N....R...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............S....R........IILLSE..GRLLNLGNATG...........................................................................
B4PDB7_DROYA/280-441             ..............................NLYSCKESIL..DSL...K....R..S..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.D.............VGKGCAQ.ALK.GQG.C...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............N........V.....D...I.....V.....V....T....A.....T....G....N....K...N....VV...VR.E.HM.D.K..MKS.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..N.G.L.RTP....DL..........T.W.EK.V.R.S......Q......VD...H.........I..........I........W........P......E........G.............K....Y........IILLAE..GRLVNLSCSS-i..........................................................................
A3J3Z9_9FLAO/197-358             ..............................NKYGCKESAV..DAV...R....R..A..T.D.I...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFR.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............K.............L.......N............T.........V............V...G...............I........A.....D...I.....I.....I....T....T.....T....G....N....K...D....IV...LG.S.HF.E.Q..MKD.KT..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NKN...hGA..........S.K.IE.I.K.P......Q......VD...K.........Y..........T........I........A......-........G.............N....D........IIILAE..GRLVNLGCATG...........................................................................
SAHH_RHOBA/196-366               ..............................NLYGCRESLA..DGV...K....R..A..T.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAH.SLK.SYG.C...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........A............C...K...............E........G.....R...L.....Y.....V....T....T.....T....G....N....K...D....II...LG.E.HM.K.Q..MPN.DA..IL..C.N.....I...G..H...FD..TEI.D.....I..A.W.A.EQQvadgKA..........T.V.SE.I.K.P......Sdi..gaVD...R.........F..........T........F........N......D.......tG.............R....S........IIILAK..GRLVNLGCATG...........................................................................
H3BEW1_LATCH/277-438             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...V...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....M.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
SAHH_STRCO/243-405               ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....T.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......D............E.........V............V...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MA.K.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AQT...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........Y........P......D........G.............K....V........LIVLSE..GRLLNLGNATG...........................................................................
Q2JWE2_SYNJA/193-354             ..............................NRYGTGQSTL..DGI...L....R..C..T.N.I...L...LAG...K.....T.....VV.VA.G.Y.G.W.............CAKGVAM.RAR.GMG.S...Q...V.I.....V..T.....E...V..N.......P....V...R........A......L....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......A............E.........A............A...S...............L........G.....D...L.....F.....I....T....V.....T....G....N....K...H....VI...RG.E.HF.D.R..MKD.GA..MV..C.N.....A...G..H...FD..IEI.D.....L..V.A.L.QER....TV..........S.R.QT.V.R.P......F......VE...E.........Y..........R........L........Q......S........G.............K....S........VFVLGE..GRLINLAAAE-g..........................................................................
F2KS93_ARCVS/170-330             ..............................NRYGTGQSAI..DGI...L....R..A..T.N.M...L...LAG...K.....T.....IV.VA.G.Y.G.W.............CGRGIAM.RAR.GMG.A...K...V.V.....V..T.....E...V..D.......E....I...R........A......L....E....A.........L...M....D......G.......F....D.....V.....M.............P.............M.......E............K.........A............A...R...............I........G.....D...I.....F.....I....T....A.....T....G....N....R...D....VI...RK.E.HL.E.L..MKD.GA..VL..A.N.....A...G..H...FN..VEI.A.....I..P.E.L.ENM....SR..........G.K.RE.M.R.D......N......VV...E.........Y..........D........L........G......D........K.............-....K........LYLLAE..GRLVNLVAAD-g..........................................................................
A3W4F2_9RHOB/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...G...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.A..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
H5WGH2_RALSL/231-390             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.V.EKY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....K........IIILAK..GRLVNLGCATG...........................................................................
Q1ZK07_PHOAS/205-347             .........................sgflk----------..---...-....-..-..-.-.-...-...---...-.....-.....AG.VI.G.A.G.N.............LGRGVIK.HLK.AKGiT...N...I.H.....V..T.....D...I..D.......P....R...K........L......T....Q....F.........P...R....D......G.......I....Q.....A.....C.............S.............I.......K............Y.........L............V...E...............H........C.....N...M.....L.....F....C....C.....T....G....N....Q...S....I-...TP.E.MI.D.A..LSQ.PI..FI..S.T.....V...T..S...AD..DEL.H.....L..P.D.L.LQQ...gVL..........T.E.VK.T.N.R......L......TK...E.........Y..........K........T........R......H........G.............H....S........VYLFAG..GESAN------tpfktg.....................................................................
F4H4D2_CELFA/282-451             ..............................NRYGIRHSLP..DGL...D....R..A..T.D.V...L...IGG...K.....V.....AF.VA.G.Y.G.D.............VGKGAAE.ALR.GQG.A...R...V.L.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....V.............R.............L.......D............D.........V............V...G...............E........V.....D...F.....V.....V....T....A.....T....G....D....R...G....VV...TV.E.HL.A.A..MKD.KA..VV..G.N.....I...G..H...FD..DEI.D.....M..A.G.L.AAH...pGV..........R.R.TE.I.K.P......Q......VH...E.........W..........T........F........P......Adpa.tgrpE.............R....S........VVVLSE..GRLLNLGNATG...........................................................................
D2H433_AILME/182-343             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....T...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........W........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
D9U9W7_PHATA/7-24                ..............................NLYCCRESIL..DGL...K....R..T..T.D.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
B6QRV5_PENMQ/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAQ.ALA.SMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......F....Q.....V.....T.............T.............M.......E............E.........A............A...P...............V........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...VG.R.HF.E.V..MKN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........A......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
F7VDW9_9PROT/189-348             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........G.....D...I.....F.....V....T....A.....T....G....N....V...D....VI...TV.D.HM.R.A..MKN.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..E.A.L.RNF....--..........K.W.DN.V.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
B8GYC7_CAUCN/224-383             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...LSG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.QGG.A...R...V.I.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....Q.............T.............L.......N............D.........V............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....K...D....VI...TV.D.DM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..SEI.Q.....I..A.G.L.RNF....--..........K.W.DE.I.K.P......Q......VH...H.........V..........E........F........P......D........G.............K....K........LIVLSE..GRLVNLGNATG...........................................................................
H0P8Y8_9SYNC/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....IV.VA.G.Y.G.W.............CGKGVAM.RAK.GMG.A...D...V.I.....V..T.....E...I..S.......P....V...P........A......I....E....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......A............E.........A............A...H...............Q........G.....D...I.....F.....I....T....V.....T....G....N....K...H....VI...RP.E.HF.A.V..MKD.GA..IV..C.N.....S...G..H...FD..IEI.D.....L..K.S.L.KEQ....AK..........E.V.KE.V.R.N......F......TE...Q.........Y..........I........L........P......N........G.............K....S........IIVIGE..GRLVNLAAAE-g..........................................................................
SAHH_BRUME/227-386               ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
E8WN23_GEOS8/225-384             ..............................NIYGCRESLM..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.IC.G.Y.G.D.............VGKGCAQ.AMR.GLQ.A...Q...V.W.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............W.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....I...D....VI...TH.D.HM.K.A..MKH.NA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.K.L.RQY....--..........K.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
E4NR00_HALBP/192-353             ..............................NIHGTGESSL..ANI...A....M..T..T.N.V...S...FAS...K.....N.....VV.VA.G.Y.G.Y.............CGKGVAK.KAA.GQN.A...N...V.I.....V..A.....E...V..E.......P....R...R........A......L....E....A.........H...M....E......G.......Y....D.....V.....M.............P.............M.......N............E.........A............A...K...............V........G.....D...I.....F.....V....T....T.....T....G....N....R...D....II...TE.E.DF.E.V..MKD.GA..IL..S.N.....A...G..H...FD..IEI.D.....L..D.A.L.SDL....AV..........D.E.YE.A.R.D......G......VQ...A.........Y..........E........M........E......D........G.............R....R........LNVLAE..GRLVNLAS---pia........................................................................
C1DWN0_SULAA/185-346             ..............................NRYGTGQSTI..DGI...L....R..A..T.N.R...L...IAG...S.....K.....FV.VA.G.Y.G.W.............CGKGVAM.RAR.GMG.A...D...V.I.....V..T.....E...V..D.......P....L...K........A......L....E....A.........V...M....D......G.......Y....R.....V.....M.............P.............M.......I............E.........A............A...K...............I........G.....D...F.....F.....V....T....V.....T....G....N....I...N....VI...DK.Q.HL.E.V..MKD.GA..IV..S.N.....S...G..H...FD..VEI.N.....L..K.A.L.QEM....AV..........K.T.RD.I.R.E......N......VK...E.........Y..........T........L........K......D........G.............R....N........IYVLAE..GRLVNLAAAE-g..........................................................................
C0BKL7_9BACT/197-302             ..............................NKYGCKESAV..DAI...R....R..A..T.D.V...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFK.GAG.A...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............K.............L.......S............N.........V............I...G...............N........A.....D...I.....V.....C....T....A.....T....G....N....K...D....IL...KK.R.IF.S.S..AK-.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------gqgnc......................................................................
C9YE72_9BURK/1-66                ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...-....-......-.......-....-.....-.....-.............-.............-.......-............-.........-............-...-...............-........-.....-...-.....-.....-....-....-.....-....-....-....-...-....--...--.-.--.-.-..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.SKC....--..........K.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......Akg...kkaS.............K....R........IILLAK..GRLVNLGCGTG...........................................................................
E6UNE6_CLOTL/184-345             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...I...VAG...K.....N.....VV.VV.G.Y.G.W.............CGKGIAM.RAK.GLG.A...S...V.I.....V..C.....E...V..D.......P....I...K........A......A....E....A.........V...M....D......G.......Y....K.....V.....M.............P.............M.......M............E.........A............A...K...............I........G.....D...L.....F.....I....T....A.....T....G....C....S...R....VI...HR.E.HF.K.V..MKD.GA..IL..C.N.....A...G..H...FD..VEV.S.....V..K.D.L.EEM....AV..........R.K.EE.Q.R.K......N......IM...G.........Y..........M........M........E......D........G.............R....W........INLLAE..GRLVNLAAG--dg.........................................................................
G3HAN8_CRIGR/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....V...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........R........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
F6A341_GARVH/263-419             ........gtgetcvttmqqilgsecfkna----------..---...-....-..-..-.-.-...-...---...-.....K.....VT.VV.G.Y.G.P.............VGRGFAL.RIR.ALG.A...K...V.T.....I..C.....D...T..N.......P....V...Q........S......L....R....A.........V...F....D......G.......F....E.....A.....K.............N.............L.......E............C.........V............V...K...............K........S.....N...M.....I.....V....S....A.....T....G....V....R...H....TI...TL.Q.HM.Q.N..MQE.NA..IL..A.V.....I...G..G...IA..NEI.A.....L..D.E.I.PDF....--..........-.K.PV.V.G.T......S......QR...K.........I..........Q........V........P......C........G.............P....Q........ITLISE..GDGTNY-----ttggg......................................................................
SAHH_WHEAT/240-403               ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......I....Q.....I.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..N.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tK.............T....G........IIVLAE..GRLMNLGCATG...........................................................................
A5V9R4_SPHWW/230-389             ..............................NLYGCKESLV..DAI...R....R..A..T.D.V...M...LAG...K.....I.....AC.VA.G.F.G.D.............VGKGSAQ.SLR.NGG.A...R...V.M.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............E.........A............V...T...............R........A.....D...I.....F.....V....T....A.....T....G....N....A...D....VI...TA.E.HM.A.A..MKP.MS..IV..C.N.....I...G..H...FD..SEI.Q.....I..A.A.L.SNY....--..........S.W.TE.V.K.P......G......TD...L.........V..........K........F........P......D........G.............K....Q........IIVLAK..GRLVNLGCATG...........................................................................
SAHH_PNECA/199-360               ...........................ikl---RCRESLI..DGI...K....R..A..T.D.I...M...IAA...K.....V.....AI.VA.G.F.G.D.............VGKGCAK.ALR.GMG.A...R...V.I.....I..T.....E...I..D.......P....I...V........A......L....Q....A.........S...M....E......G.......Y....Q.....V.....A.............V.............M.......E............E.........V............A...D...............Q........A.....D...I.....F.....V....T....A.....T....G....C....K...D....II...CE.R.HF.E.A..MKN.DA..II..C.N.....I...G..H...FD..VEI.D.....V..A.W.L.IKK....CS..........S.I.SN.I.K.P......Q......VD...R.........Y..........L........L........G......N........G.............R....N........IILLAE..GRLVNLGCATG...........................................................................
D1CFK4_THET1/180-341             ..............................NRYGTGQSTI..DGL...L....R..A..T.N.I...L...LAG...K.....V.....FV.VA.G.Y.G.W.............CGKGLAS.RAR.GMG.C...Q...V.V.....V..T.....E...V..D.......P....I...K........A......L....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......T............E.........A............A...K...............I........A.....D...V.....I.....V....T....V.....T....G....G....L...H....AV...NA.E.AV.Q.N..LKD.GV..IL..A.N.....S...G..H...FN..DEI.D.....I..P.A.I.EKL....SV..........A.R.RM.R.R.D......F......VE...E.........F..........E........L........K......D........G.............R....K........IYLLAE..GRLLNLSAAEG...........................................................................
B5DFN2_RAT/241-402               ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
C3Y544_BRAFL/194-354             ..............................NLYGCRESLL..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VA.G.F.G.D.............VGKGSAQ.SLR.GLG.A...R...V.I.....I..T.....E...A..D.......P....I...N........A......L....Q....A.........A...I....S......G.......Y....E.....V.....T.............T.............M.......E............E.........A............C...V...............V........G.....N...I.....F.....V....T....T.....T....G....N....K...D....II...RS.E.HM.L.Q..MKE.DA..IL..A.N.....I...G..H...FD..CEV.D.....V..Q.W.L.NKN....-A..........E.K.VN.I.K.P......Q......VD...R.........Y..........T........L........P......N........G.............R....H........VLLLAE..GRLVNLGCAMG...........................................................................
B5K6Y3_9RHOB/226-385             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VM.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.I.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......D............D.........V............V...E...............T........A.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.R.R..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......N........G.............H....R........LILLSE..GRLLNLGNATG...........................................................................
H3PB89_BRUAO/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
SAHH_CYAP7/196-357               ..............................NRYGTGQSTL..DGI...I....R..A..T.N.V...L...LAG...K.....T.....VV.VA.G.Y.G.W.............CGKGTAM.RAR.GLG.A...N...V.I.....V..T.....E...I..N.......A....V...K........A......I....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......I............E.........A............A...P...............L........G.....D...L.....F.....V....T....V.....T....G....N....K...H....VI...RP.E.HF.D.V..MKD.GA..IV..C.N.....S...G..H...FD..IEI.D.....L..Q.S.L.GEK....AS..........E.I.KE.V.R.N......F......TQ...Q.........Y..........T........L........A......S........G.............K....S........IVVLGE..GRLINLAAAE-g..........................................................................
G5GMN4_9FIRM/184-345             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.L...V...IAG...K.....T.....VV.IA.G.Y.G.W.............CGKGGAM.RAR.GLG.A...N...V.I.....I..T.....E...V..D.......P....I...K........A......I....E....A.........V...F....D......G.......F....Y.....V.....M.............P.............M.......D............E.........A............A...K...............V........G.....D...I.....F.....L....T....L.....T....G....N....K...D....IL...CK.R.HF.D.V..MKD.GA..MM..A.N.....S...G..H...FD..VEI.N.....I..P.E.L.TEG....SA..........S.N.KV.V.R.E......N......IR...E.........F..........V........Q........P......D........G.............R....R........LYLLAE..GRLVNLAAG--dg.........................................................................
H0Y8B3_HUMAN/277-438             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
F2LVT6_HIPMA/185-346             ..............................NRYGTGQSTI..DGI...L....R..A..T.N.R...L...IAG...S.....V.....FV.VC.G.Y.G.W.............CGKGLAS.RAK.GMG.A...N...V.I.....V..T.....E...T..D.......A....L...R........A......L....E....A.........V...M....D......G.......F....R.....V.....M.............P.............I.......K............E.........A............A...K...............I........G.....D...F.....F.....C....T....V.....T....G....D....I...H....VI...RK.E.HF.E.L..MKD.GT..IV..A.N.....S...G..H...FD..VEI.D.....V..K.G.L.RGI....AV..........S.Q.RD.I.R.P......F......VR...E.........Y..........K........L........K......N........G.............R....R........IYLLAE..GRLVNLSAAEG...........................................................................
Q2JKS3_SYNJB/193-354             ..............................NRYGTGQSTL..DGI...L....R..C..T.N.I...L...LAG...K.....T.....VV.VA.G.Y.G.W.............CAKGVAM.RAR.GMG.S...Q...V.I.....V..T.....E...V..N.......P....V...R........A......L....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......E............E.........A............A...A...............L........G.....D...I.....F.....I....T....V.....T....G....N....K...H....VI...RG.E.HF.D.R..MKD.GA..MV..C.N.....A...G..H...FD..IEI.D.....L..V.A.L.QER....AV..........S.R.QT.V.R.P......F......VE...E.........Y..........R........L........Q......S........G.............K....S........VVVLGE..GRLINLAAAE-g..........................................................................
F3M1N0_9LACO/180-328             ........................adygtt----------..---...-....-..-..-.-.-...-...LLG...K.....K.....AL.VI.G.Y.G.K.............VGSSIAD.NLR.KRG.A...I...V.I.....V..A.....D...K..R.......A....I...R........L......A....N....A.........L...A....H......G.......Y....Q.....I.....T.............N............dI.......Y............T.........E............L...I...............D........V.....D...I.....V.....Y....I....A.....N....G....E....K...S....ID...A-.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------lqlkkldlkhtsysfsvtsaddtfknsqiinelphyghnggyrilktksnktvilansgnainftysis......
SAHH_HALS3/192-353               ..............................NVHGTGESAL..ANI...A....M..T..T.N.L...S...WAG...K.....D.....VV.VA.G.Y.G.D.............CGRGVAK.KAA.GQN.A...N...V.I.....V..T.....E...V..E.......P....R...R........A......L....E....A.........H...M....E......G.......Y....D.....V.....M.............P.............M.......A............E.........A............A...E...............V........G.....D...V.....F.....L....T....T.....T....G....N....K...N....VI...TR.A.HF.E.R..MDD.GV..VL..A.N.....A...G..H...FD..VEV.N.....L..D.H.L.SEL....AV..........S.E.RE.A.R.E......G......VR...E.........Y..........E........L........A......D........G.............R....R........LNVLAE..GRLVNLAS---pig........................................................................
D4U1Y4_9ACTO/1-119               .............................l----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.--G.A...R...V.T.....V..V.....E...L..D.......P....V...R........A......L....Q....A.........S...M....D......G.......F....A.....V.....A.............S.............L.......Q............E.........A............T...A...............S........A.....G...M.....L.....I....S....A.....T....G....E....R...A....TI...PL.S.AL.E.A..APE.GA..IV..T.V.....A...G..G...VD..GEV.S.....I..D.E.A.VAA...sWV..........M.A.ES.G.D.P......H......VQ...T.........L..........T........S........P......S........G.............K....T........LHILER..GEGINYTA---geg........................................................................
F3Q2Y6_9ENTR/160-309             .........................whtff----------..---...-....Q..T..T.H.L...T...LHE...K.....K.....VL.VI.G.Y.G.L.............VGQGVAA.AAK.AFG.G...Q...V.M.....V..A.....E...I..D.......P....A...R........R......L....Q....A.........A...Y....D......G.......W....H.....V.....V.............D.............L.......Q............E.........A............I...A...............S........A.....D...V.....V.....A....T....A.....T....G....G....K...N....VV...NR.Q.AL.D.R..AKA.GV..FI..L.N.....V...G..H...VA..EEI.D.....G..D.Y.L.RQY....--..........P.Q.EE.V.M.P......Y......IN...A.........Y..........R........M........A......D........-.............K....T........VYLLAN..GSMLNLTAG--fg.........................................................................
C9TWP8_9RHIZ/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
H0YZQ0_TAEGU/196-357             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.SFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....T...D....IV...QG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEV.D.....A..K.W.L.NDN....AV..........E.A.VN.I.K.P......Q......VD...R.........Y..........T........L........R......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
Q6P743_RAT/191-352               ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....V...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........W........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
G3PDT1_GASAC/333-494             ..............................NLYSCKESIL..DGL...K....R..T..T.G.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.T...I...M.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......I............E.........V............A...R...............Q........V.....D...L.....V.....I....T....C.....T....G....N....K...H....VV...GR.E.HL.E.R..MKD.GC..IL..C.N.....M...G..N...SS..SEI.D.....L..G.S.L.QTA....EL..........R.W.ER.V.R.P......Q......VD...H.........V..........V........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
H8I6W9_METCZ/181-342             ..............................NRYGTGQSTL..HGI...M....N..A..T.N.V...L...LAG...K.....T.....VV.IV.G.Y.G.W.............CGRGVAM.RAR.GMG.S...N...V.I.....I..V.....E...V..H.......P....R...K........A......L....E....A.........V...M....D......G.......Y....R.....V.....M.............D.............M.......E............Q.........A............A...R...............E........G.....D...I.....F.....I....T....V.....T....G....D....I...S....VI...RK.E.HF.K.L..MKD.QA..IV..C.N.....S...G..H...FN..VEI.D.....L..K.D.L.GAM....AK..........N.V.RE.V.K.A......D......VM...E.........Y..........E........M........K......D........G.............R....R........IYLLGE..GRLVNLACAF-g..........................................................................
F8FU58_PSEPU/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Spfid....ginngT.......E............A.........S............I...Dka..........llgK........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........H........RtgagsfdpQ......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
E9HK94_DAPPU/201-362             ..............................NLYSCKESII..DSL...K....R..A..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCSQ.ALK.ALG.S...V...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....L.............K.............L.......S............E.........V............I...R...............N........V.....D...L.....L.....I....T....A.....T....G....N....K...N....VL...TR.E.YM.D.K..MKS.GA..IV..C.N.....M...G..H...SN..TEI.D.....V..N.S.L.RTP....DL..........T.W.EK.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....K........IILLAE..GRLVNLSCSS-v..........................................................................
F5SD58_9BACL/186-347             ..............................NRYGTGQSVW..DGI...N....K..A..T.N.L...V...VAG...K.....T.....VV.VV.G.Y.G.W.............CGRGVAM.RAQ.GLG.A...R...V.V.....V..A.....E...V..D.......P....I...K........A......T....E....A.........H...M....D......G.......F....T.....L.....L.............P.............M.......A............E.........A............A...K...............V........G.....E...I.....F.....V....T....V.....T....G....N....K...K....VI...TE.E.HF.S.L..MRD.GA..IL..A.N.....A...G..H...FD..VEI.D.....K..P.S.L.EEL....AV..........S.K.RT.V.R.K......D......IT...E.........Y..........Q........L........A......D........G.............R....R........IHLLCD..GRLVNLVA---gdg........................................................................
H3BIH2_LATCH/266-427             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCVQ.ALR.SFG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............C...K...............E........A.....N...I.....F.....V....T....T.....T....G....C....K...D....II...LG.R.HF.E.E..MKD.DA..IV..C.N.....I...G..H...FD..IEL.D.....V..K.W.L.NSN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........K........L........K......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
SAHH_AGRT5/227-386               ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLQ.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............R.............L.......E............D.........V............V...S...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.RNL....--..........K.W.TN.I.K.P......Q......VD...M.........I..........E........F........P......K........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
SAHH_HUMAN/191-352               ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....I...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........R........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
#=GR SAHH_HUMAN/191-352    SS    ..............................HHHHHHHHHH..HHH...H....H..H..H.-.-...-...-TT...S.....E.....EE.EE.-.-.S.H.............HHHHHHH.HHH.HTT.-...E...E.E.....E..E.....-...S..-.......H....H...H........H......H....H....H.........H...H....T......T.......-....E.....E.....-.............-.............H.......H............H.........H............T...T...............T........-.....S...E.....E.....E....E....-.....S....S....S....S...-....SB...-H.H.HH.T.T..S-T.TE..EE..E.E.....-...S..S...SS..TSB.-.....H..H.H.H.HHH....ES..........E.E.EE.E.E.T......T......EE...E.........E..........E........E........T......T........S.............-....E........EEEEGG..GSBHHHHSS--...........................................................................
F3E9E4_PSESL/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidgendgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DS.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgpgsfdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
H0W4G1_CAVPO/252-413             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...L.....L.....V....K....P.....G....R....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IILLAE..GRLLNLSCST-v..........................................................................
D4ZY15_SPIPL/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.V...L...LAG...K.....N.....VV.VV.G.Y.G.W.............CGKGSAL.RAR.GLG.A...N...V.I.....V..T.....E...V..D.......P....V...R........A......I....E....A.........V...M....D......G.......F....R.....V.....M.............P.............M.......E............Q.........A............A...A...............V........G.....D...L.....F.....I....T....V.....T....G....N....K...H....VI...RG.E.HF.D.V..MKD.GA..MV..C.N.....S...G..H...FD..IEI.D.....L..K.A.L.AER....ST..........E.I.KE.V.R.N......F......TQ...Q.........Y..........K........L........K......T........G.............K....S........VVVLGE..GRLINLAAAE-g..........................................................................
B5DP84_DROPS/268-429             ..............................NLYSCKESIL..DSL...K....R..S..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.D.............VGKGCAQ.ALK.GQG.C...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............N........V.....D...I.....V.....V....T....A.....T....G....N....K...N....VV...VR.E.HM.D.K..MKS.GC..IV..S.N.....M...G..H...SN..TEI.D.....V..N.G.L.RTP....DL..........T.W.EK.V.R.S......Q......VD...H.........I..........I........W........P......E........G.............K....Y........IILLAE..GRLVNLSCSS-i..........................................................................
I0DVF4_PROST/188-349             ..............................NRYGVGSSVV..ESI...A....H..A..T.N.V...M...IHG...K.....K.....VV.VI.G.Y.G.Y.............CGSGVAQ.RFR.GMG.A...H...V.T.....V..V.....D...T..N.......P....L...T........R......L....E....A.........H...L....E......G.......F....Q.....T.....A.............E.............L.......L............D.........T............L...C...............D........A.....D...F.....V.....V....S....V.....V....G....R....D...N....IL...TS.K.HF.T.A..MKD.NV..IV..A.N.....A...G..H...FQ..REV.D.....I..K.A.L.NSI....TS..........S.C.ED.V.T.P......N......IN...R.........Y..........Q........L........K......T........G.............K....N........IFLMSD..ANLVNLSAGN-g..........................................................................
F2HTN5_BRUMM/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
F7C6T2_HORSE/191-350             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.V.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...R...............E........G.....N...I.....F.....V....T....T.....T....G....C....I...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VR...S.........P..........-........S........P......A........S.............R....V........GRWRAE..AGMLNLGC---vl.........................................................................
G6CUJ8_DANPL/1-143               ..............................----------..---...-....-..-..-.-.-...M...FGG...K.....Q.....AA.VC.G.Y.G.E.............VGKGCCQ.ALK.ALG.C...V...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....A.....T....G....N....K...G....VV...TR.D.HM.E.R..MKN.GC..VV..C.N.....M...G..H...SN..TEV.D.....V..H.A.L.RTP....DL..........M.W.ER.V.R.S......Q......VD...H.........I..........I........W........G......N........G.............K....R........IVLLAE..GRLANLCCSS-l..........................................................................
C8XJI5_NAKMY/257-418             ..............................NKYGIRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....V.....AL.VA.G.Y.G.D.............VGKGAAE.SLR.GQG.A...R...V.V.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........L...M....D......G.......F....E.....V.....S.............T.............V.......D............K.........A............V...E...............R........A.....D...L.....I.....I....T....T.....T....G....N....K...D....II...TV.A.HM.S.R..MKH.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARS....GA..........S.K.IE.I.K.P......Q......VD...E.........W..........R........F........A......D........G.............H....T........IIVLSA..GRLLNLGNATG...........................................................................
H2QVC8_PANTR/370-531             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
B9CJC3_9BURK/233-392             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
D1C2U0_SPHTD/190-352             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....VV.VA.G.Y.G.W.............CGKGIAM.RAR.GMG.A...K...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........V...M....D......G.......Y....R.....V.....M.............P.............M.......V............D.........A............A...P...............E........G.....D...I.....F.....I....T....A.....T....G....N....I...N....VI...DR.Q.HF.E.A..MKD.GA..IL..A.N.....A...G..H...FN..AEI.N.....L..T.M.L.DDI....AV..........E.G.RE.VlR.P......Y......VE...E.........Y..........R........L........S......G........G.............K....R........IIVLGE..GRLINLVAAE-g..........................................................................
SAHH_RHOSH/224-383               ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............V...Q...............D........A.....D...I.....F.....I....T....T.....T....G....N....R...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.D......Q......VD...M.........I..........E........M........P......S........G.............S....R........IILLSE..GRLLNLGNATG...........................................................................
G1LF84_AILME/309-470             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...SR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
H2GFA7_CORDP/236-398             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............H.............V.......D............Q.........A............I...G...............D........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.A..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.L.LHR...dDV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............K....S........IVVLSE..GRLLNLGNATG...........................................................................
E2TRB0_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
Q4P829_USTMA/188-349             ..............................NYYGCRESLV..DGI...K....R..A..T.D.V...M...LGG...K.....V.....AI.VA.G.F.G.D.............VGKGCAE.SLR.GYG.C...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........S...M....A......G.......Y....Q.....V.....D.............I.............M.......D............D.........V............A...S...............Q........A.....D...I.....F.....V....T....T.....T....G....C....R...D....II...TG.K.HF.E.A..MKD.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AQ..........S.V.SN.I.K.P......Q......VD...R.........Y..........T........L........K......N........G.............N....R........IILLAE..GRLVNLGCATG...........................................................................
SAHH_RHOP2/230-389               ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...LSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............D.........A............A...P...............L........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....I..A.H.L.KNL....--..........K.W.DN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............K....R........MILLSE..GRLVNLGNAMG...........................................................................
C6E2K7_GEOSM/226-385             ..............................NIYGCRESLM..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.IC.G.Y.G.D.............VGKGCAQ.AMR.GLQ.A...Q...V.W.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............W.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....I...D....VI...TH.D.HM.K.A..MKH.NA..IV..C.N.....I...G..H...FD..NEI.E.....V..A.K.L.KQY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCATG...........................................................................
G1RQ14_NOMLE/370-531             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
E9CHK0_CAPO3/192-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAA.SLK.SMG.A...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....T.............T.............M.......E............V.........A............C...A...............E........G.....N...I.....F.....V....T....T.....T....G....N....K...D....II...TR.K.HF.E.H..MHD.DA..IV..C.N.....I...G..H...FD..CEI.E.....V..A.Y.L.NQI....-A..........K.K.VQ.I.K.P......Q......VD...R.........Y..........T........M........P......S........G.............K....H........IIILAE..GRLVNLGCARG...........................................................................
H0SHD7_9BRAD/232-391             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.M.....V..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TI.E.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.S.L.KNL....--..........K.W.TN.I.K.P......Q......VD...E.........I..........T........F........P......D........G.............K....R........MILLSE..GRLVNLGNAMG...........................................................................
A3WQN6_9GAMM/197-373             ..............................NKYGCRHSLN..DAI...K....R..S..T.D.H...L...MSG...K.....K.....AL.VI.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....V..T.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....VspyidgvnsddgsT.............I.......N............K.........A...........lL...G...............N........I.....D...L.....L.....V....T....T.....T....G....N....V...N....VC...DR.H.ML.A.A..IKS.TA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........R.W.EE.I.K.P......Q......VH...K.........I..........Y........R........S......Dd......dN.............D....Y........LLLLAE..GRLVNLGNATG...........................................................................
C5ZF88_BURPE/234-393             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
E1K152_DESFR/234-396             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............C...P...............L........G.....D...I.....F.....V....T....A.....T....G....C....C...D....VI...TG.A.HM.E.K..MKD.GA..IV..C.N.....I...G..H...FD..SEI.S.....V..A.Y.L.EST...pTC..........K.K.DQ.I.K.P......L......VD...K.........W..........T........M........A......S........G.............N....A........ILMLAE..GRLVNLGCATG...........................................................................
H2Z7J3_CIOSA/243-406             ..............................NLYSCRESVL..DGL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.E.............VGKGCCS.ALK.GLG.A...V...S.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......I....R.....V.....V.............R.............L.......H............E.........V............V...K...............T........A.....D...I.....F.....I....T....C.....S....G....N....K...N....VI...TR.E.SL.D.K..MKN.GA..IV..C.N.....M...G..H...SN..TEI.D.....VvcT.L.L.KTN....DL..........T.W.EK.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
Q0AXW6_SYNWW/194-355             ..............................NRYGTGQSVW..DGI...N....R..S..T.N.L...V...VAG...K.....N.....VV.VA.G.Y.G.W.............CGKGVSM.RAL.GMG.A...R...I.I.....I..T.....E...I..D.......P....I...K........A......N....E....A.........I...M....D......G.......F....E.....V.....M.............P.............M.......S............T.........A............A...T...............L........G.....D...I.....F.....I....T....V.....T....G....N....I...N....VI...RK.E.HM.A.V..MKD.KA..IM..A.N.....A...G..H...FD..VEI.N.....K..N.D.L.AAL....AV..........S.R.RI.V.R.N......N......IE...E.........F..........K........L........A......D........G.............R....R........LYLLAE..GRLVNLAAG--dg.........................................................................
Q5L7L6_BACFN/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............D.........A............C...K...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...pGI..........K.R.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
D5BTB0_PUNMI/225-384             ..............................NLYGCRESLV..DAI...R....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.F.G.D.............VGKGSAA.SLR.QGG.A...R...V.M.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............Q.........A............A...P...............K........A.....D...I.....F.....V....T....A.....T....G....N....R...D....II...TV.D.HM.R.E..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..S.A.L.NNM....--..........V.W.SE.V.K.P......Q......VD...E.........I..........E........F........P......D........G.............K....R........MILLAK..GRLVNLGCATG...........................................................................
A4X3J2_SALTO/254-416             ..............................NRYGCRHSLV..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VV.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.V.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......E............D.........V............V...E...............T........A.....D...I.....F.....I....T....A.....T....G....C....F...D....VI...TN.E.HM.A.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARR...aDV..........T.R.EN.V.K.P......Q......VD...V.........W..........R........F........D......D........G.............H....A........VIVLSE..GRLLNLGNATG...........................................................................
Q383X0_TRYB2/190-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AC.VC.G.Y.G.D.............VGKGCAA.ALR.GFG.A...R...V.V.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....L.............L.............V.......E............D.........V............V...E...............E........A.....H...I.....F.....V....T....T.....T....G....N....D...D....II...TS.E.HF.P.R..MRD.DA..IV..C.N.....I...G..H...FD..TEI.Q.....V..A.W.L.KAN....AK..........E.R.VE.V.K.P......Q......VD...R.........Y..........T........M........A......N........G.............R....H........IILLAE..GRLVNLGCASG...........................................................................
#=GR Q383X0_TRYB2/190-351  SS    ..............................HHHHHHHHHH..HHH...H....H..H..H.-.-...-...-TT...-.....E.....EE.EE.-.-.S.H.............HHHHHHH.HHH.HTT.-...E...E.E.....E..E.....-...S..-.......H....H...H........H......H....H....H.........H...H....T......T.......-....E.....E.....-.............-.............H.......H............H.........H............T...T...............T........-.....S...E.....E.....E....E....-.....S....S....-....S...-....SB...-T.T.TG.G.G..S-T.TE..EE..E.E.....-...S..S...SG..GGB.-.....H..H.H.H.HHH....-S..........E.E.EE.E.E.T......T......EE...E.........E..........E........-........T......T........S.............-....E........EEEEGG..GS-HHHHHS--...........................................................................
SAHH_BURXL/234-393               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...GH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.DN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
F9J0M7_ACIBA/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............N....Y........LILLSE..GRLVNLGNATG...........................................................................
F6FRM5_ISOV2/263-435             ..............................NKYGIRHSLP..DGI...N....R..A..T.D.I...L...IGG...K.....V.....AF.VA.G.Y.G.D.............VGKGAAE.AFR.GQG.A...R...V.I.....V..S.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....A.............R.............I.......E............D.........V............L...G...............E........A.....D...F.....F.....I....T....T.....T....G....N....K...D....VI...RV.E.HM.V.A..MKD.KA..VV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AAV...pGV..........V.K.TE.I.K.P......Q......VH...E.........W..........T........F........P......A........Gvgpdg...verseR....S........IIVLSE..GRLLNLGNATG...........................................................................
Q5FRZ9_GLUOX/198-357             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............N.........A............A...P...............R........G.....D...I.....F.....V....T....C.....T....G....N....V...D....II...TI.D.HM.R.E..MKD.RA..IV..C.N.....I...G..H...FD..SEI.Q.....V..E.A.L.RNY....--..........R.W.NN.I.K.P......Q......VD...E.........I..........E........L........A......P........N.............R....R........IILLSE..GRLVNLGNATG...........................................................................
Q9M677_CUCME/1-85                ..............................----------..-GL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......Q....-...S........V......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............W.......K............M.........L............S...R...............-........-.....R...L.....I.....S....R....H.....T....R....N....K...D....II...MV.D.HI.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------gr.........................................................................
D1CUK7_9RHIZ/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
A9DZ30_9RHOB/224-383             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VM.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............L.............L.......E............D.........V............V...A...............T........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......N........G.............N....R........LILLSE..GRLLNLGNATG...........................................................................
G4M0M7_SCHMA/279-440             ..............................NFYLCKESIV..DSL...K....R..T..T.D.M...M...ISG...K.....T.....VL.VC.G.Y.G.E.............VGKGVCQ.ALR.GLG.A...F...V.C.....I..S.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......Y....R.....V.....V.............K.............I.......D............E.........V............I...R...............S........V.....D...I.....V.....V....T....C.....T....G....N....K...G....VI...TR.A.HM.D.Q..MKS.GC..VV..C.N.....M...G..H...SN..TEI.D.....V..R.S.L.QTP....DL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........M......D........G.............K....R........IVLIAE..GRLANLSCST-v..........................................................................
SAHH_CUPPJ/231-390               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AI.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............A...E...............H........G.....D...I.....F.....V....T....C.....T....G....N....Y...H....VI...TH.D.HM.A.R..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.I.EKY....--..........E.W.DE.I.K.P......Q......VD...H.........V..........K........F........P......D........G.............K....K........IIILAK..GRLVNLGCATG...........................................................................
C5BTQ5_TERTT/198-374             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....K.....AL.VV.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....V..T.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....Vspynd...gintgK.............A.......Edi........nlE.........V............L...S...............K........T.....D...L.....I.....V....T....T.....T....G....N....T...N....VC...DA.A.ML.Q.T..LKN.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RAN....-W..........E.W.EE.V.K.P......Q......VH...K.........I..........Y........R........D......Ks......tN.............N....H........LILLSE..GRLVNLGNATG...........................................................................
F7NPB2_9FIRM/184-344             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.L...T...VTG...K.....T.....VV.IA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.L.....I..T.....E...V..D.......P....I...K........A......I....E....A.........A...F....D......G.......F....G.....V.....T.............D.............M.......G............D.........A............A...K...............R........G.....D...I.....F.....I....T....V.....T....G....C....K...D....VI...RE.E.HF.K.V..MKS.GA..IL..A.N.....A...G..H...FD..VEI.N.....K..N.D.L.NKL....AH..........S.R.RV.V.R.K......N......IE...E.........F..........A........L........A......D........-.............R....K........LYLLAE..GRLVNLAAG--dg.........................................................................
I1AUF0_9RHOB/223-382             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.K.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............L.............L.......E............D.........V............I...D...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......G........G.............S....R........IILLSE..GRLLNLGNATG...........................................................................
B4PWM7_DROYA/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....CC.VA.G.Y.G.D.............VGKGCAQ.ALK.GFG.G...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............S...K...............E........A.....S...I.....F.....V....T....T.....T....G....C....R...D....II...TS.V.HL.Q.Q..MPD.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..D.W.L.NAN....AK..........E.K.VN.V.K.P......Q......VD...R.........Y..........T........M........Q......S........G.............K....H........IILLAE..GRLVNLGCAHG...........................................................................
B8GEX2_METPE/177-336             ..............................NVHGTGESVL..SAV...M....I..T..T.N.V...L...IAG...K.....Y.....LV.VA.G.Y.G.F.............CGRGLAR.KAH.GLG.A...K...V.I.....V..T.....E...V..D.......P....R...K........A......L....E....A.........H...M....D......G.......F....L.....V.....M.............S.............M.......A............E.........A............A...R...............L........G.....D...I.....F.....V....T....V.....S....G....N....A...H....VI...NS.T.HF.S.Q..LKD.GA..IL..A.N.....A...G..H...FN..VEI.D.....I..D.W.L.EAH....A-..........S.G.KE.S.R.D......G......ID...T.........Y..........L........L........-......D........G.............K....R........IHILAE..GRLVNLAT---pkg........................................................................
F9ZPD9_ACICS/196-380             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.H...L...LSG...K.....R.....AL.VM.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....V.............Spy........vggI.......N............Dgt.....pdC............I...Drs..........llgQ........I.....D...L.....L.....V....T....A.....T....G....N....V...N....VC...DA.E.IL.K.A..LKK.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKH....-W..........A.W.EE.V.K.P......Q......VH...K.........VyrqipaggkvD........L........G......D........D.............D....Y........LILLSE..GRLVNLGNATG...........................................................................
G1T1W6_RABIT/378-539             ..............................NLYCCRESIL..DGL...K....R..T..T.D.M...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
SAHH_ACIAC/235-394               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAQ.ALA.ALR.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....K...D....VI...RH.E.HM.V.A..MKN.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EKY....--..........R.W.EE.V.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........ITLLAK..GRLVNLGCATG...........................................................................
G2SL70_RHOMR/189-350             ..............................NVYGTGQSTI..DGI...L....R..A..T.S.V...L...LAG...K.....N.....FV.VA.G.Y.G.H.............CGRGVAM.RAR.GMG.A...N...V.I.....V..T.....E...V..K.......P....T...A........A......L....K....A.........V...L....D......G.......F....R.....V.....M.............P.............M.......D............E.........A............A...E...............I........G.....D...I.....F.....V....T....A.....T....G....M....K...D....VI...RG.R.HF.R.K..MKD.GA..IV..C.N.....T...G..H...YD..VEL.N.....L..K.E.L.AEL....AV..........R.V.RE.V.R.P......N......NK...E.........Y..........L........L........E......N........G.............R....R........IYVLAD..GRLVNLAAAE-g..........................................................................
A2DVT9_TRIVA/244-406             ..............................NIYGCRHSLI..DGI...N....R..A..S.D.V...M...IGG...K.....T.....AL.VM.G.Y.G.D.............VGKGCAQ.SLR.GQG.A...R...V.I.....I..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....R.............R.............I.......E............E.........V............V...K...............D........V.....D...I.....F.....V....T....C.....T....G....N....C...D....II...TV.D.MM.A.Q..MKD.KA..IV..G.N.....I...G..H...FD..NEI.D.....T..E.G.L.KNC...pGI..........K.H.IP.I.K.P......E......YD...M.........W..........E........F........P......D........G.............H....A........ILLLAE..GRLLNLGCATG...........................................................................
F7UXX2_EEGSY/187-348             ..............................NHYGTGQSTL..DGI...V....R..A..T.N.R...L...LCG...R.....T.....IV.IS.G.Y.G.Y.............CGSGLAL.RAK.GMG.M...R...V.I.....V..C.....E...V..D.......P....L...K........A......L....E....A.........H...M....E......G.......Y....E.....V.....M.............P.............A.......A............E.........A............A...R...............F........A.....D...V.....W.....V....T....V.....T....G....N....C...K....VV...DA.P.AF.E.N..MKD.GA..IV..C.N.....S...G..H...FD..SEI.N.....L..E.W.L.REH....AV..........K.V.EE.I.K.P......L......VE...E.........Y..........T........L........A......D........G.............R....T........VIVLAQ..GRLVNLSCAEG...........................................................................
G8R0T8_OWEHD/197-358             ..............................NKYGCKESAV..DAI...R....R..A..T.D.I...M...LAG...K.....R.....VI.VC.G.Y.G.D.............VGKGTAA.SFR.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............R.............L.......E............T.........V............I...G...............K........A.....D...I.....V.....I....T....T.....T....G....N....K...D....IV...AG.R.HF.E.A..MKD.KT..IV..C.N.....I...G..H...FD..NEI.D.....V..S.W.L.KTN...hGN..........T.H.VN.I.K.P......Q......VD...K.........Y..........T........V........-......N........G.............N....D........IILLAE..GRLVNLGCATG...........................................................................
Q5R045_IDILO/195-371             ..............................NKYGCRHSLN..DAI...K....R..S..T.D.H...L...LSG...K.....K.....AL.VV.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....I..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Sp...........yL.......EgknngtgdninkD.........L............L...S...............N........T.....D...L.....I.....V....T....T.....T....G....N....M...D....VC...DR.Y.ML.A.A..LKP.TA..LV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........R.W.EE.I.K.P......Q......VH...K.........I..........Y........R........S......Dd......dN.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
A0RXE6_CENSY/187-348             ..............................NRYGTGQSTI..DGY...L....R..S..M.N.L...L...LAS...K.....R.....VV.VA.G.Y.G.W.............VGKGVAA.RCR.GMG.S...R...V.M.....V..T.....E...V..N.......P....V...R........A......L....E....A.........H...M....E......G.......Y....E.....V.....V.............P.............M.......S............R.........A............A...P...............A........G.....D...I.....F.....I....T....C.....T....G....M....T...G....II...RK.E.HI.D.K..MKD.GA..VM..G.N.....V...G..H...FD..VEI.D.....T..K.Y.L.LKK....SR..........S.V.RE.I.R.P......N......LD...E.........C..........V........L........K......N........G.............R....R........VYLVGK..GWLANLVAAE-g..........................................................................
Q7T2B5_DANRE/271-432             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCS.ALK.ALG.A...I...V.C.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............V...R...............Q........M.....D...M.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VILLAE..GRLLNLSCST-v..........................................................................
A9BIK7_PETMO/178-339             ..............................NRYGTGQSTW..DGI...M....R..S..T.N.L...S...VSG...K.....I.....VV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...N...V.I.....I..T.....E...V..D.......P....I...K........A......N....E....A.........I...M....D......G.......F....R.....V.....M.............K.............M.......D............E.........A............V...K...............Y........G.....D...F.....F.....V....T....V.....T....G....D....I...D....VI...TK.R.HF.L.E..MKE.GA..IL..S.N.....A...G..H...FD..VEV.K.....V..K.D.L.EEV....AV..........D.K.IN.V.R.N......G......VE...E.........Y..........K........L........P......N........G.............K....S........VFLLGQ..GRLVNLVNG--dg.........................................................................
H2YAU7_CIOSA/190-350             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AL.VA.G.Y.G.D.............VGKGSVQ.SLK.AFG.C...R...V.I.....I..S.....E...I..D.......P....I...N........A......L....Q....A.........A...M....G......R.......Y....E.....L.....T.............I.............I.......S............Q.........A............A...P...............R........A.....N...I.....I.....V....T....T.....T....G....C....K...D....II...TA.D.IF.Q.K..LPN.DC..IV..C.N.....I...G..H...FD..CEL.D.....V..A.W.L.NAN....AV..........E.K.IQ.V.K.P......Q......VD...R.........Y..........T........M........A......S........G.............K....H........I-LLAE..GRLVNLGCATG...........................................................................
G2UI80_PSEAI/195-377             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSSQ.SLR.QEG.M...I...V.K.....V..A.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Spy........kngI.......N............DgteasidaaL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgkdgfdA........H......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
B6VC73_GOSHI/240-403             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.N.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ENY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......E.......tN.............T....G........IIVLAE..GRLMNLGCATG...........................................................................
F4B1B5_KROS4/197-358             ..............................NKYGCRESAV..DAI...R....R..A..T.D.T...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFK.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............K.............L.......N............S.........V............V...G...............N........A.....D...I.....V.....I....T....T.....T....G....N....K...D....II...RP.E.HF.E.A..MKD.KV..IV..C.N.....I...G..H...FD..NEI.D.....M..G.W.L.NST...hGA..........T.K.DE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IIVLAE..GRLVNLGCATG...........................................................................
H2QK78_PANTR/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.GFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............C...Q...............E........G.....N...I.....F.....V....T....T.....T....G....C....I...D....II...LG.R.HF.E.Q..MKD.DA..IV..C.N.....I...G..H...FD..VEI.D.....V..K.W.L.NEN....AV..........E.K.VN.I.K.P......Q......VD...R.........Y..........R........L........K......N........G.............R....R........IILLAE..GRLVNLGCAMG...........................................................................
Q2RNQ7_RHORT/226-385             ..............................NKYGCRESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSSE.SLR.SSG.C...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........G.....D...I.....F.....V....T....T.....T....G....N....I...D....VI...TL.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNL....--..........T.W.NN.V.K.P......Q......VD...E.........I..........T........F........P......D........G.............H....R........IILLAQ..GRLVNLGCATG...........................................................................
G5J1M5_CROWT/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.V...L...LAG...K.....V.....AV.VA.G.Y.G.W.............CGKGVAM.RAR.GLG.A...N...V.I.....V..T.....E...I..D.......P....V...R........A......I....E....A.........A...M....D......G.......F....R.....V.....M.............P.............M.......A............E.........A............A...Q...............Q........G.....D...V.....F.....I....T....V.....T....G....N....K...H....VI...RP.E.HF.E.V..MKD.GA..MV..C.N.....S...G..H...FD..IEI.D.....L..E.S.L.GAK....AS..........E.V.KE.V.R.N......F......TQ...K.........Y..........T........L........P......S........G.............K....A........IVVLGE..GRLINLAAAE-g..........................................................................
G2WCS6_YEASK/194-355             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAA.ALR.GMG.A...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....V.............T.............M.......E............D.........A............S...H...............I........G.....Q...V.....F.....V....T....T.....T....G....C....R...D....II...NG.E.HF.I.N..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KAN....AK..........E.C.IN.I.K.P......Q......VD...R.........Y..........L........L........S......S........G.............R....H........VILLAN..GRLVNLGCATG...........................................................................
H2TK42_TAKRU/266-427             ..............................NLYCCKESVL..DGL...K....R..S..T.D.V...M...FGG...K.....Q.....VL.VC.G.Y.G.E.............VGKGCCA.ALK.AVG.A...V...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............M.......K............E.........V............V...R...............R........V.....D...M.....V.....S....P....V.....Q....G....N....K...N....VV...VR.K.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....L..A.S.L.RTA....EL..........R.W.ER.V.R.S......H......VD...H.........V..........I........W........P......D........G.............K....R........ILLLAE..GRLLNLTCST-v..........................................................................
G2LSZ4_9XANT/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....N.............T.............I.......E............S.........T............L...G...............R........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....II...TV.E.HL.Q.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KAL...kDV..........Q.K.IN.I.K.P......Q......VD...K.........Y..........V........F........P......N........G.............N....A........IFLLAD..GRLVNLGCATG...........................................................................
E3GW01_METFV/184-345             ..............................NRYGTGQSTF..DAI...M....G..T..T.N.M...L...IAG...K.....T.....VV.VC.G.Y.G.W.............CGKGIAL.RAK.GLG.A...E...V.I.....V..T.....E...V..D.......P....I...R........A......L....E....A.........R...M....D......G.......F....R.....V.....M.............K.............I.......S............D.........A............V...K...............Y........A.....D...I.....L.....I....T....A.....T....G....N....I...D....VV...TR.K.EF.E.N..MKD.GC..IL..A.N.....S...G..H...FN..VEI.N.....R..N.D.L.IDI....SI..........S.H.KK.I.N.E......D......IE...E.........F..........V........L........E......D........G.............R....R........LYLLAE..GRLVNLASSR-g..........................................................................
SAHH_ARCFU/173-333               ..............................NRYGTGQSAI..DGV...I....R..A..T.N.L...L...MAG...K.....I.....VV.VA.G.Y.G.W.............CGRGIAM.RAR.GMG.A...S...V.V.....V..T.....E...V..D.......E....I...R........A......L....E....A.........V...M....D......G.......F....R.....V.....M.............R.............M.......E............D.........A............A...K...............I........G.....D...I.....F.....I....T....A.....T....G....N....R...D....II...RE.E.HI.R.L..MKD.GA..IL..A.N.....A...G..H...FN..VEI.D.....I..P.A.L.ERM....AK..........A.K.RE.A.R.K......Y......VT...E.........Y..........D........L........G......D........K.............-....R........VYLLAE..GRLVNLVAAD-g..........................................................................
H2M594_ORYLA/362-523             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...VR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
B7FT14_PHATC/238-398             ..............................NLYGCKHSLP..DGL...M....R..A..T.D.V...M...LAG...K.....K.....AV.IA.G.Y.G.D.............VGKGCAA.AMR.ACG.C...V...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....E......G.......Y....Q.....V.....V.............T.............L.......E............D.........V............V...D...............T........A.....D...I.....F.....I....T....T.....T....G....N....K...G....IL...MC.E.TM.S.K..MKN.NA..IV..G.N.....I...G..H...FD..NEI.D.....M..D.G.L.MKA....-A..........K.R.IN.I.K.P......Q......VD...K.........F..........V........F........E......S........G.............N....G........IIVLAE..GRLLNLGCATG...........................................................................
C4KD20_THASP/232-391             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TH.D.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EQY....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAK..GRLVNLGCATG...........................................................................
I0GQ60_SELRU/184-345             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.L...V...IAG...K.....T.....VV.IA.G.Y.G.W.............CGKGGAM.RAR.GLG.A...N...V.V.....I..T.....E...V..D.......P....I...K........A......I....E....A.........V...F....D......G.......F....R.....V.....M.............P.............M.......D............E.........A............A...K...............I........G.....D...I.....F.....L....T....L.....T....G....D....K...D....VI...VK.R.HF.E.S..MKD.GA..ML..A.N.....S...G..H...FD..CEI.N.....I..P.E.L.ESL....SK..........S.R.RK.V.R.N......N......IE...E.........F..........L........Q........P......D........G.............R....K........IYLLAE..GRLVNLAAG--dg.........................................................................
H1YYT6_9EURY/175-334             ..............................NVHGTGESAL..SAV...M....I..T..T.N.S...L...IGG...K.....W.....FV.VA.G.Y.G.Y.............CGRGLAK.MAH.GLG.A...K...V.V.....V..T.....E...I..D.......P....R...R........A......L....E....A.........H...M....D......G.......Y....H.....V.....M.............S.............M.......A............E.........A............A...K...............I........G.....D...I.....F.....V....T....T.....T....G....N....T...S....VI...SE.K.DF.R.N..MKD.GV..IL..S.N.....A...G..H...FN..VEI.D.....I..P.W.L.EAN....-K..........D.G.YE.A.R.D......S......IE...T.........Y..........I........I........D......N........-.............K....R........INILAE..GRLVNLATM--kg.........................................................................
B5XPI3_KLEP3/177-326             .........................whtff----------..---...-....Q..T..T.H.L...T...LHE...K.....K.....VL.VI.G.Y.G.L.............VGQGVAA.AAK.AFG.G...Q...V.M.....V..A.....E...I..D.......P....A...R........R......L....Q....A.........A...Y....D......G.......W....H.....V.....V.............D.............L.......Q............E.........A............I...A...............S........A.....D...V.....V.....A....T....A.....T....G....G....K...N....VV...NR.Q.AL.E.R..AKA.GV..FI..L.N.....V...G..H...VA..EEI.D.....G..E.Y.L.RQY....--..........P.Q.EE.V.M.P......Y......IN...A.........Y..........R........M........A......D........-.............K....T........IYLLAN..GSMLNLSAG--fg.........................................................................
B7I3L1_ACIB5/197-372             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nhD.........L............L...G...............N........T.....D...L.....V.....V....T....T.....T....G....N....Y...H....VC...DA.A.ML.D.S..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..A.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......Ed......eN.............D....Y........LILLSE..GRLVNLGNATG...........................................................................
F2NKV6_MARHT/186-347             ..............................NRYGTGQSTL..DGI...L....R..A..T.N.V...L...LAG...K.....T.....VV.VI.G.Y.G.W.............CGRGIAS.RAR.GLG.A...N...V.V.....V..T.....E...V..D.......P....L...R........A......L....E....A.........V...M....E......G.......F....S.....V.....T.............S.............M.......R............E.........A............A...R...............V........G.....D...V.....F.....I....T....A.....T....G....N....Q...H....VI...DR.E.HL.E.V..MKD.GA..IL..A.N.....A...G..H...FN..VEI.N.....I..P.A.L.EAL....AV..........E.K.RE.P.R.P......F......VT...Q.........Y..........L........L........A......D........G.............R....R........LHLLGE..GRLINLAAAE-g..........................................................................
H5U5A3_9ACTO/295-456             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............Q.........A............I...G...............D........A.....D...I.....V.....V....T....S.....T....G....N....K...D....II...LL.E.HM.K.Q..MKN.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ENS....GA..........T.R.IN.I.K.P......Q......VD...Q.........W..........V........F........G......D........G.............K....S........ILVLSE..GRLLNLGNATG...........................................................................
H8IYR9_MYCIT/248-410             ..............................NKYGCRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGSAE.SVA.GQG.A...R...V.T.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....E......G.......F....D.....V.....K.............R.............V.......E............D.........V............I...G...............E........A.....D...I.....I.....I....T....T.....T....G....N....K...D....II...TL.E.HM.K.A..MKD.KA..IL..G.N.....I...G..H...FD..NEI.Q.....I..A.R.L.EKS....GA..........T.K.TN.I.R.P......Q......VD...L.........W..........T........F........P......D.......tG.............K....S........IIVLSE..GRLLNLGNATG...........................................................................
A4B9W4_9GAMM/178-326             ......................qafcqrty----------..---...-....-..-..-.-.L...T...LHE...K.....Q.....IT.LL.G.Y.G.L.............VGQGVAA.AAK.AYG.G...H...V.T.....V..V.....E...H..D.......P....A...R........A......L....M....A.........R...Y....D......G.......W....A.....T.....G.............E.............L.......N............D.........L............L...A...............Q........T.....D...V.....L.....V....T....A.....T....G....A....K...G....IV...GL.P.EL.S.A..LKD.GA..FV..M.N.....V...G..H...GT..GEI.R.....V..H.E.L.DSL....--..........S.A.TE.V.L.P......H......VF...E.........Y..........N........L........N......-........Q.............R....S........IYLLAN..GAMFNLTAG--fg.........................................................................
Q5X3N1_LEGPA/202-361             ..............................NLYGCRESLL..DGL...K....R..A..T.D.V...M...IAG...K.....V.....AL.IL.G.Y.G.D.............VGKGCAQ.ALR.GQG.A...T...V.L.....V..A.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............L.......D............D.........V............A...E...............Q........V.....D...I.....V.....V....T....A.....T....G....N....Y...H....VV...TH.D.HM.K.R..MRN.QA..IL..C.N.....I...G..H...FD..SEI.D.....I..Q.S.L.KQY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IIILAE..GRLVNLGCATG...........................................................................
D0NEK2_PHYIT/237-397             ..............................NLYGCRHSLP..DGI...M....R..A..T.D.V...M...LAG...K.....R.....IV.IC.G.F.G.D.............VGKGSAQ.AMK.AAG.A...I...V.Y.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........C...M....E......G.......F....Q.....V.....V.............R.............L.......E............T.........V............V...S...............E........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.K.DM.L.K..MKN.NA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.V.TKI....-A..........K.R.QN.I.K.P......Q......VD...R.........F..........I........F........E......D........G.............H....A........VIVLAE..GRLLNLGCATG...........................................................................
B0WWT2_CULQU/216-379             .............................s-LYSCKESVI..DSL...K....R..A..T.D.I...M...IGG...K.....Q.....VV.LC.G.Y.G.E.............VGKGCAQ.ALK.GLG.C...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............T........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HM.D.K..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..N.S.L.RTS....EL..........Q.W.EK.M.R.S......Q......VD...H.........I..........I........W........Pg....pD........G.............K....R........IILLAE..GRLVNLSCSS-v..........................................................................
Q5W1I5_NICGL/19-182              ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............D........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETY...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
D2W1E4_NAEGR/233-395             ..............................NIYGCRHSLL..DGL...N....R..A..T.D.V...M...LAG...K.....E.....CV.VC.G.F.G.D.............VGKGCAE.ALK.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........C...M....A......G.......Y....T.....V.....K.............T.............I.......E............D.........C............L...E...............T........A.....D...V.....Y.....V....T....A.....T....G....N....K...D....II...TL.D.HM.K.K..MKD.TA..II..C.N.....I...G..H...FD..NEI.D.....V..L.G.L.KTC...eGV..........K.E.IN.I.K.P......Q......VD...Q.........F..........V........F........P......D........G.............H....T........ILLLAQ..GRLVNLGCATG...........................................................................
H3DAX7_TETNG/267-428             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....I.....I....T....C.....T....G....N....K...N....VV...TR.D.QL.D.R..MKN.AS..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IILLAE..GRLLNLSCST-v..........................................................................
D8JRB7_HYPDA/230-389             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MAG...K.....I.....AM.VA.G.F.G.D.............VGKGSAA.SLR.NAG.C...R...V.M.....V..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TV.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....I..A.G.L.KNF....--..........K.W.NN.I.K.P......Q......VD...E.........I..........E........F........P......T........G.............R....R........IILLSE..GRLVNLGNAMG...........................................................................
I0GIU1_9BACT/174-335             ..............................NRYGTGQSTW..DAI...M....R..T..T.N.L...N...IAG...K.....N.....VV.VV.G.Y.G.W.............VGKGVAM.RAR.GLG.A...R...V.I.....V..T.....E...V..D.......P....I...K........A......I....E....A.........Y...M....D......G.......F....D.....V.....M.............E.............M.......K............N.........A............A...K...............V........G.....D...I.....F.....V....T....T.....T....G....N....T...N....VI...DS.R.HF.E.L..LKD.GA..IL..T.N.....A...G..H...FN..VEI.A.....M..D.E.L.EKE....KV..........S.K.RE.V.R.Q......N......IM...E.........Y..........T........L........K......N........G.............R....H........IYVLGE..GRLVNLACADG...........................................................................
D0TJP8_9BACE/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........A............V...K...............E........G.....N...I.....F.....V....T....T.....T....G....N....C...D....II...TI.E.HM.T.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.K.L.VNY...pNI..........K.H.TN.I.K.P......Q......VD...K.........Y..........T........F........P......N........G.............N....S........IFLLAE..GRLVNLGCATG...........................................................................
D9YAW6_9DELT/233-395             ..............................NLYGCRESLA..DGI...K....R..A..T.D.I...M...VAG...K.....V.....VV.IC.G.Y.G.D.............VGKGCAQ.SMR.GFG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............V.......E............D.........A............L...P...............L........G.....D...I.....Y.....V....T....C.....T....G....N....Y...H....VI...TG.A.HM.E.G..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....M..N.Y.L.ENT...pGV..........S.R.LN.I.K.P......Q......VD...K.........W..........T........L........K......S........G.............R....S........ILILAE..GRLVNLGCATG...........................................................................
C7HI31_CLOTM/184-345             ..............................NRYGTGQSVW..DGI...N....R..T..T.N.L...I...VAG...K.....N.....VV.VV.G.Y.G.W.............CGKGIAM.RAK.GLG.A...S...V.I.....V..C.....E...V..D.......P....I...K........A......A....E....A.........V...M....D......G.......Y....K.....V.....M.............P.............M.......M............E.........A............A...K...............I........G.....D...L.....F.....I....T....A.....T....G....C....S...R....VI...HR.E.HF.K.V..MKD.GA..IL..C.N.....A...G..H...FD..VEV.S.....V..K.D.L.EEM....AV..........R.K.EE.Q.R.K......N......IM...G.........Y..........M........M........E......D........G.............R....W........INLLAE..GRLVNLAAG--dg.........................................................................
D5SVR7_PLAL2/202-370             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...VAG...K.....V.....VV.IC.G.Y.G.D.............VGKGSAA.SMK.GLG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......Y....Q.....V.....T.............T.............L.......E............E.........V............A...P...............Y........A.....D...I.....F.....V....T....T.....T....G....C....R...D....II...RA.E.HL.D.V..MKN.NA..IV..C.N.....I...G..H...FD..LEI.E.....I..A.Y.L.NNR...kDI..........K.K.TR.I.K.S......DqdeggpVD...R.........Y..........A........Y........P......D........G.............R....G........IIVLAE..GRLVNLGCANG...........................................................................
E1NKP8_9LACO/182-330             ........................adygtt----------..---...-....-..-..-.-.-...-...LLG...K.....K.....AL.VI.G.Y.G.K.............VGSSIAD.NLR.KRG.A...I...V.I.....V..A.....D...K..R.......A....I...R........L......A....N....A.........L...A....H......G.......Y....Q.....I.....T.............N............dI.......Y............T.........E............L...I...............D........I.....D...I.....V.....Y....I....A.....N....G....E....K...S....ID...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------alqlkkldlkhtlysfsvtsaddtfknsqiinelphyghnggyrilktksnktvilansgnainftysis.....
F5XX10_RAMTT/237-397             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...VAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....R.....I.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....R...D....VI...TY.A.HM.A.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EKK....-C..........R.W.EE.I.K.P......Q......VD...H.........V..........I........F........D......D........G.............K....R........IILLAK..GRLVNLGCGTG...........................................................................
C4KXJ0_BURPE/234-393             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
D7E1N9_NOSA0/192-353             ..............................NRYGTGQSTL..DGI...I....R..A..T.N.I...L...LAG...K.....T.....VV.VV.G.Y.G.W.............CGKGTAL.RAR.GMG.A...N...V.I.....V..T.....E...I..D.......H....I...K........A......I....E....A.........V...M....D......G.......F....R.....V.....L.............P.............M.......A............E.........A............A...P...............L........G.....D...I.....F.....I....T....V.....T....G....N....K...H....VV...RG.E.HF.D.V..MKD.GA..IV..C.N.....S...G..H...FD..LEL.D.....L..K.Y.L.AAN....AK..........E.I.KD.V.R.P......F......TE...E.........Y..........K........L........T......N........G.............K....S........VVVLGQ..GRLINLAAAE-g..........................................................................
G0R4D6_ICHMG/233-395             ..............................NVYGCRHSLP..DGI...F....R..A..T.D.V...M...IAG...K.....K.....VV.IC.G.Y.G.D.............VGKGSAE.AMV.GCG.A...R...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....K......G.......L....Q.....V.....V.............K.............L.......E............S.........I............L...K...............D........A.....D...I.....F.....I....T....A.....T....G....N....K...G....II...MA.E.HM.A.Q..MKN.NA..IV..G.N.....I...G..H...FD..NEI.D.....Y..N.G.L.INW...pGI..........K.K.IE.I.K.S......Q......VD...R.........F..........V........F........P......D........G.............H....G........VIVLAQ..GRLLNLGCATG...........................................................................
A4EH43_9RHOB/255-414             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............V.............L.......E............D.........V............L...D...............S........A.....D...V.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............S....R........LILLSE..GRLLNLGNATG...........................................................................
A6TBA9_KLEP7/177-326             .........................whtff----------..---...-....Q..T..T.H.L...T...LHE...K.....K.....VL.VI.G.Y.G.L.............VGQGVAA.AAK.AFG.G...Q...V.M.....V..A.....E...I..D.......P....A...R........R......L....Q....A.........A...Y....D......G.......W....H.....V.....V.............D.............L.......Q............E.........A............I...A...............S........A.....D...V.....V.....A....T....A.....T....G....G....K...N....VV...NR.Q.AL.D.R..AKA.GV..FI..L.N.....V...G..H...VA..EEI.D.....G..E.Y.L.RQY....--..........P.Q.EE.V.M.P......Y......IN...A.........Y..........R........M........A......D........-.............K....T........VYLLAN..GSMLNLTAG--fg.........................................................................
C7MUK9_SACVD/243-405             ..............................NKYGCRHSLI..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAD.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....T.............V.............L.......E............D.........V............V...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....F...N....II...TA.E.HM.S.R..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....V..A.G.L.EKI...pGI..........K.R.VE.I.K.P......Q......VD...E.........Y..........V........F........P......D........G.............H....S........IILLSR..GRLLNLGNATG...........................................................................
F7GIN0_MACMU/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
B0C8A5_ACAM1/197-373             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...MSG...K.....K.....AL.VI.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....V..T.....E...A..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....Vspytn...gvndgT.............L.......Nsi........nkD.........L............L...A...............N........T.....D...L.....V.....V....T....T.....T....G....N....F...N....VC...DA.N.ML.V.S..LKQ.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.Y.M.RQT....-W..........R.W.EE.V.K.P......Q......VH...Q.........V..........Y........R........S......Dd......pQ.............D....F........LILLSE..GRLVNLGNATG...........................................................................
A7AB33_9PORP/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VA.G.Y.G.D.............VGKGCAH.SMR.SYG.A...R...V.L.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........A............V...K...............E........G.....N...V.....F.....V....T....T.....T....G....N....C...D....II...TI.E.HM.A.Q..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.K.L.VNY...pNI..........Q.H.TN.I.K.P......Q......VD...K.........Y..........T........F........P......T........G.............N....S........IFLLAE..GRLVNLGCATG...........................................................................
D8VME5_9NEOP/53-213              ..............................NLYGCRESLL..DGI...K....R..A..T.D.I...M...IAG...K.....V.....CV.VG.G.Y.G.D.............VGKGCAQ.AFK.GFG.G...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....Q.....V.....T.............T.............M.......D............E.........A............A...E...............I........G.....Q...I.....F.....V....T....T.....T....G....N....I...D....II...CK.E.HF.V.K..MKD.DA..IV..C.N.....I...G..H...FD..CEV.D.....V..A.W.L.DKN....-A..........K.K.VN.I.K.Q......H......VD...R.........Y..........E........L........E......N........G.............N....H........IIVLAS..GRLVNLGCATG...........................................................................
H3M7E1_KLEOX/177-326             .........................whtff----------..---...-....Q..T..T.H.L...T...LHE...K.....K.....VL.VI.G.Y.G.L.............VGQGVAA.AAK.AFG.G...Q...V.M.....V..A.....E...I..D.......P....A...R........R......L....Q....A.........A...Y....D......G.......W....H.....V.....V.............E.............L.......Q............E.........A............I...A...............S........A.....D...V.....V.....A....T....A.....T....G....G....K...K....VV...NS.Q.AL.D.K..CKD.GV..FI..L.N.....V...G..H...VA..EEI.D.....C..E.Y.L.RQF....--..........S.Q.EE.V.M.P......Y......IN...A.........Y..........R........M........G......Q........-.............K....T........IYLMAN..GSMLNLTAG--fg.........................................................................
H1G1W0_9GAMM/232-391             ..............................NLYGCRESLV..DAI...K....R..A..T.D.V...M...IAG...K.....T.....AV.VC.G.Y.G.D.............VGKGSAQ.SLR.ALS.A...Q...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............E.........A............C...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....L...N....VI...TA.E.HM.A.R..MRD.QA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.G.L.RKY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............H....R........IILLAE..GRLVNLGCGTG...........................................................................
E1WZA8_BACMS/191-351             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....CV.VA.G.Y.G.D.............VGKGSAQ.SLK.GLG.G...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....M.............P.............M.......D............D.........A............A...K...............I........G.....D...I.....F.....V....T....T.....T....G....C....Y...D....VI...AA.R.HM.D.M..MKD.NA..II..S.N.....I...G..H...FD..NEI.D.....V..A.H.L.NKN....-Y..........D.K.VN.I.K.P......Q......VD...Q.........Y..........I........S........K......D........G.............R....R........LILLAE..GRLVNLGCATG...........................................................................
A5WDX4_PSYWF/209-385             ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LAG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..S.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............SpyidgkntdsaegI.......N...........tR.........L............L...Q...............D........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...DK.H.ML.A.A..LKS.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..Q.F.M.RDT....-W..........N.W.VE.I.K.P......Q......VH...Q.........V..........Y........R........S......Ed......qS.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
E1RQ35_XYLFG/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....L.....AV.VC.G.Y.G.D.............VGKGSAH.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............V.......E............D.........T............L...G...............Q........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.T.A..MKD.QV..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NAL...tGV..........Q.K.IN.I.K.P......Q......VD...K.........F..........I........L........P......N........G.............N....T........LFLLAE..GRLVNLGCATG...........................................................................
D7E8L4_METEZ/181-341             ..............................NRYGTGQSTW..DAI...N....R..T..T.N.L...L...VAG...K.....D.....VV.VA.G.Y.G.W.............CGKGVAM.YAA.GLG.A...N...V.I.....V..T.....E...V..N.......P....V...R........A......L....E....A.........R...M....D......G.......Y....R.....V.....M.............T.............M.......D............E.........A............A...E...............L........G.....D...I.....F.....V....T....T.....T....G....N....V...S....VL...TR.D.HF.K.L..MKD.GV..IL..A.N.....S...G..H...FN..VEM.N.....L..E.E.L.ESM....AH..........S.I.RK.V.K.S......N......IK...E.........Y..........N........L........K......T........-.............H....R........INVIAD..QQTVNLAAG--dg.........................................................................
D8VMC6_9NEOP/53-213              ..............................NLYGCRESLL..DGI...K....R..A..T.D.I...M...IAG...K.....V.....CV.VG.G.Y.G.D.............VGKGCAQ.AFK.GFG.G...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......F....Q.....V.....T.............T.............M.......D............E.........A............A...E...............I........G.....Q...I.....F.....V....T....T.....T....G....N....I...D....II...CK.E.HF.V.K..MKD.DA..IV..C.N.....I...G..H...FD..CEV.D.....V..A.W.L.DKN....-A..........K.K.VN.I.K.Q......H......VD...R.........Y..........E........L........E......N........G.............N....H........IIVLAS..GRLVNLGCATG...........................................................................
SAHH_VARPS/239-398               ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AC.VA.G.Y.G.D.............VGKGSAQ.ALR.ALS.A...Q...V.W.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....K.....V.....V.............T.............M.......E............Y.........A............A...D...............K........A.....D...I.....F.....V....T....T.....T....G....N....R...D....VI...RH.E.HM.A.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.I.EKY....--..........E.W.EE.I.K.P......Q......VD...H.........I..........T........F........P......D........G.............K....K........IILLAK..GRLVNLGCGTG...........................................................................
G4FN30_9SYNE/237-396             ..............................NLYGCRESLV..DSI...K....R..A..T.D.V...M...VAG...K.....Q.....AL.VV.G.Y.G.D.............VGKGSAQ.SLR.GLG.A...T...V.C.....I..A.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............R.............L.......E............D.........V............V...D...............Q........M.....D...I.....F.....V....T....A.....T....G....N....Y...Q....VI...RN.E.HL.V.K..MKD.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..A.S.L.KAY....--..........E.W.DN.I.K.P......Q......VD...H.........I..........T........L........P......S........G.............N....K........IILLAE..GRLVNLGCATG...........................................................................
B3VIF0_POPTN/1-115               ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........L...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..H.G.L.ETF...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
Q49S41_DANRE/259-420             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCS.ALK.ALG.A...I...L.C.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............V...R...............Q........M.....D...M.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VILLAE..GRLLNLSCST-v..........................................................................
B7PCR2_IXOSC/163-325             ..............................NLYSCRESIL..DAL...K....R..S..T.D.V...M...FGG...K.....Q.....VL.VC.G.Y.G.E.............VGKGCCS.ALK.GMG.A...V...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........W...M....D......E......eS....R.....T.....K.............T.............I.......R............G.........A............R...Q...............K........A.....R...V.....C.....V....L....R.....S....R....L....G...N....VV...LR.E.HM.D.K..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..Q.S.L.RTP....DL..........A.W.EK.V.R.S......Q......VD...H.........I..........I........W........P......D........G.............K....R........IVLLAE..GRLVNLSCSS-i..........................................................................
D6Y6B5_THEBD/233-395             ..............................NKYGCRHSVI..DGL...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAQ.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............V.......E............D.........V............V...E...............T........A.....D...I.....F.....I....T....A.....T....G....C....C...G....VI...TA.E.HM.A.R..MKH.QA..IV..A.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARI...pGI..........K.K.QE.I.K.P......Q......VH...E.........W..........I........F........P......D........G.............H....S........VIVLAE..GRLMNLGCATG...........................................................................
D6FLF4_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
E2UEQ0_MYCTU/253-415             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.A...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.AMK.GQG.A...R...V.S.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........M...M....E......G.......F....D.....V.....V.............T.............V.......E............E.........A............I...G...............D........A.....D...I.....V.....V....T....A.....T....G....N....K...D....II...ML.E.HI.K.A..MKD.HA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ERS....GA..........T.R.VN.V.K.P......Q......VD...L.........W..........T........F........G......D.......tG.............R....S........IIVLSE..GRLLNLGNATG...........................................................................
Q2NB41_ERYLH/230-389             ..............................NLYGCRESLV..DAI...R....R..A..T.D.V...M...LSG...K.....V.....AC.VA.G.F.G.D.............VGKGSAQ.SLR.NGG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............M.......E............E.........A............V...K...............V........A.....D...I.....F.....C....T....A.....T....G....N....E...H....VI...TA.E.HM.K.A..MKD.KA..IV..C.N.....I...G..H...FD..SEI.Q.....I..S.A.L.NNY....--..........E.W.NE.L.K.P......G......TD...V.........V..........R........F........P......D........G.............K....E........IIILGQ..GRLVNLACATG...........................................................................
A2STC1_METLZ/175-334             ..............................NVHGTGESAL..ASI...M....L..T..T.N.V...L...IAG...K.....H.....VV.VA.G.Y.G.Y.............CGRGVAT.KAR.ALG.A...R...V.I.....V..T.....E...V..D.......P....R...R........A......L....Q....A.........H...F....D......G.......F....D.....V.....M.............S.............M.......N............D.........A............A...K...............V........G.....D...L.....F.....I....T....T.....T....G....N....C...D....II...TD.H.HF.P.L..LKS.GA..IL..A.N.....A...G..H...FN..NEI.S.....I..P.W.L.ETH....-A..........S.S.VE.H.R.D......G......ID...T.........Y..........L........I........G......D........-.............K....K........IHLLAE..GRLVNLAT---pkg........................................................................
SAHH_DICDI/191-351               ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.SLS.KMG.A...R...V.L.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........C...M....D......G.......Y....Q.....I.....V.............T.............M.......E............T.........A............A...P...............L........S.....N...I.....F.....V....T....T.....T....G....C....R...D....IV...RG.E.HF.A.V..MKE.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..A.W.L.NAN....-A..........K.K.DT.V.K.P......Q......VD...R.........Y..........T........L........A......N........G.............V....H........IILLAE..GRLVNLGCGTG...........................................................................
SAHH_COXBU/199-358               ..............................NLYGCRESLI..DSI...K....R..A..T.D.V...M...IAG...K.....R.....VV.VC.G.Y.G.D.............VGKGCAQ.SLR.AYG.A...T...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............E.........M............A...D...............S........A.....D...I.....F.....V....T....A.....T....G....N....T...D....II...TH.E.HM.L.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.L.QDY....--..........Q.W.MN.I.K.P......Q......VD...Q.........V..........I........F........P......D........G.............K....R........LTVLAQ..GRLVNLGCATG...........................................................................
E8RMM4_ASTEC/249-408             ..............................NLYGCRESLV..DAI...R....R..A..T.D.V...M...LAG...K.....V.....AV.VL.G.Y.G.D.............VGKGSAA.SLR.NGG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....R.............T.............V.......E............E.........V............A...K...............L........G.....D...I.....F.....V....T....A.....T....G....N....K...D....VL...RL.E.HM.R.E..MKH.NA..IV..C.N.....I...G..H...FD..SEI.Q.....V..A.S.L.RNY....--..........K.W.DE.I.K.P......Q......VH...H.........V..........E........F........P......D........G.............K....K........IIVLSE..GRLVNLGNATG...........................................................................
B1I2P2_DESAP/185-346             ..............................NRYGTGESVW..SGI...M....R..T..T.N.L...L...VAG...K.....T.....VV.VF.G.Y.G.W.............CGRGIAM.RAR.GLG.A...K...V.I.....V..C.....E...V..D.......P....V...R........A......I....E....A.........H...M....D......G.......Y....R.....V.....M.............H.............S.......L............E.........A............A...R...............L........G.....N...V.....F.....I....S....A.....T....G....C....R...D....VI...HA.G.HF.Q.V..MPD.QA..LL..A.N.....A...G..H...FN..VEI.S.....G..P.D.L.ERL....AV..........S.R.RT.V.R.P......N......IE...E.........F..........Q........L........A......D........G.............R....R........LYLLAR..GRLVNLAAG--dg.........................................................................
F4DLI2_PSEMN/193-375             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAA.SLR.QEG.M...I...V.K.....V..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....L.....V.............Spy........idgI.......N............Dgt.....daC............I...Dka..........llgK........I.....D...L.....I.....V....T....T.....T....G....N....A...N....VC...DA.G.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........H........RtgagsfdpA......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
F8ADT9_THEID/185-346             ..............................NRYGTGQSTI..DGI...L....R..A..T.N.R...L...LAG...S.....I.....FV.VA.G.Y.G.W.............CGKGVAM.RAK.GLG.A...R...V.V.....V..T.....E...V..D.......P....L...K........A......I....E....A.........V...M....D......G.......Y....D.....V.....M.............P.............M.......D............E.........A............A...E...............I........G.....D...F.....F.....C....T....L.....T....G....D....I...N....VI...RK.E.HF.L.K..MKD.GA..IV..S.N.....S...G..H...FN..VEL.D.....L..D.G.L.KEV....SR..........E.V.RR.V.R.E......N......VD...E.........Y..........T........L........V......N........R.............K....K........VYILAE..GRLVNLAAAE-g..........................................................................
D6V2K9_9BRAD/229-388             ..............................NLYGCRESLV..DGI...R....R..G..T.D.V...M...MSG...K.....V.....AM.VA.G.F.G.D.............VGKGSAA.SLR.QAG.C...R...V.L.....V..S.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....E.....V.....V.............T.............M.......E............D.........A............A...P...............R........A.....D...I.....F.....V....T....A.....T....G....N....K...D....II...TL.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..NEI.Q.....V..A.T.L.KNL....--..........K.W.TN.I.K.P......Q......VD...E.........I..........T........F........A......D........G.............H....R........IILLSE..GRLVNLGNAMG...........................................................................
Q4TEC7_TETNG/65-239              .............................s-LYCCKESVL..SGL...K....R..T..T.D.V...M...FGG...K.....Q.....VL.VC.G.Y.G.EvgeadqltsclaqVGKGCCA.ALK.AVG.A...V...V.Y.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............R.............M.......E............E.........V............A...A...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...VR.K.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....L..A.S.L.RTA....EL..........R.W.ER.V.R.S......H......VD...H.........V..........I........W........P......D........G.............K....R........ILLLAE..GRLLNLSCST-v..........................................................................
C9CY57_9RHOB/223-381             ..............................NKYGCKESLV..DGI...R....R..A..T.D.T...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLS.GAG.A...R...V.K.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....E.....V.....V.............L.............L.......E............E.........A............L...-...............D........A.....D...I.....F.....I....T....T.....T....G....N....K...D....IL...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.N.L.KNH....--..........K.W.TN.I.K.E......Q......VD...M.........I..........E........M........P......S........G.............N....R........LILLSE..GRLLNLGNATG...........................................................................
A0K3E9_BURCH/233-392             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......E............Y.........A............A...D...............R........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...NH.D.HM.K.A..MRH.NA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.T.RQY....--..........Q.W.EN.I.K.P......Q......VD...H.........I..........I........F........P......D........G.............K....R........VILLAE..GRLVNLGCATG...........................................................................
A5CW73_VESOH/197-373             ..............................NKYGCRHSLN..DAI...K....R..S..T.D.M...L...MSG...K.....K.....VL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEN.M...I...V.K.....I..S.....E...I..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....I.....I.............Spying...intglI.......Dni........nkD.........L............L...N...............T........T.....D...L.....I.....V....T....A.....T....G....N....I...N....VC...DN.T.ML.Q.T..LKP.GA..VV..C.N.....I...G..H...FD..NEI.D.....T..Q.Y.M.RDN....-W..........R.W.DE.I.K.P......Q......VH...R.........I..........F........R........T......D........N.............Kn..dY........LILLSE..GRLVNLGNATG...........................................................................
Q4RBV4_TETNG/1-93                ..............................----------..---...-....-..-..-.-.-...-...---...-.....-.....--.--.-.-.-.-.............-------.---.---.-...-...-.-.....-..-.....-...-..-.......-....-...-........-......-....-....-.........-...M....D......G.......F....R.....V.....V.............R.............M.......E............E.........V............A...A...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...VR.K.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..SEI.DlvpaaV..C.Q.L.RTA....EL..........R.W.ER.V.R.N......H......VD...H.........V..........I........W........P......D........G.............K....R........ILLLAE..-----------...........................................................................
G3NHJ8_GASAC/192-353             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCVQ.ALR.GFG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............S...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....E...D....II...LG.H.HF.E.N..MKD.DA..IV..C.N.....I...G..H...FD..CEI.D.....M..G.W.L.TKN....AA..........E.K.IN.I.K.P......Q......VD...R.........Y..........R........M........K......S........G.............R....H........IIILAE..GRLVNLGCAMG...........................................................................
F5RM84_9FIRM/184-345             ..............................NRYGTGQSTW..DGI...M....R..T..T.N.L...V...IAG...K.....T.....VV.IA.G.Y.G.W.............CGKGGAM.RAR.GLG.A...N...V.I.....I..T.....E...V..D.......P....I...K........A......I....E....A.........V...F....D......G.......F....Y.....V.....M.............P.............M.......D............E.........A............A...K...............V........G.....D...I.....F.....L....T....L.....T....G....N....K...D....IL...CK.R.HF.D.V..MKD.GA..MM..A.N.....S...G..H...FD..VEI.N.....I..P.E.L.TEG....ST..........S.N.EV.V.R.D......N......IR...E.........F..........V........Q........P......D........G.............R....R........LYLLAE..GRLVNLAAG--dg.........................................................................
D6WMI3_TRICA/191-352             ..............................NLYGCRESLI..DGI...K....R..A..T.D.I...M...LAG...K.....V.....CV.VA.G.Y.G.D.............VGKGCAQ.SLR.AFG.G...R...V.I.....I..T.....E...I..D.......P....I...I........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............S...K...............E........G.....Q...I.....F.....V....T....T.....T....G....C....K...D....II...LG.Q.HF.L.N..MRN.DS..IV..C.N.....I...G..H...FD..CEI.D.....V..S.W.L.EKN....AK..........S.K.TN.I.K.P......Q......VD...R.........Y..........L........L........A......N........G.............N....H........VIVLAE..GRLVNLGCATG...........................................................................
Q3RF05_XYLFA/238-400             ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....L.....AV.VC.G.Y.G.D.............VGKGSAH.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....R.............T.............V.......E............D.........T............L...G...............Q........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.T.A..MKD.QV..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NTL...tGV..........Q.K.IN.I.K.P......Q......VD...K.........F..........I........L........P......N........G.............N....T........LFLLAE..GRLVNLGCATG...........................................................................
G8B6I2_CANPC/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAL.ALQ.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......Y....Q.....V.....A.............P.............L.......D............E.........V............A...S...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....II...VG.K.HF.E.K..MPE.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KEN....AQ..........S.V.VN.I.K.P......Q......VD...R.........Y..........L........M........K......N........G.............R....H........IILLAD..GRLVNLGCATG...........................................................................
G0FNL9_AMYMD/248-410             ..............................NRYGIRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGAAE.SLR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....A.....V.....R.............K.............L.......E............S.........V............L...P...............E........A.....D...I.....I.....I....T....T.....T....G....N....K...D....VV...LV.E.HM.A.K..MKH.QA..IL..G.N.....I...G..H...FD..NEL.D.....M..A.G.L.ARY...pGI..........R.K.IN.I.K.P......Q......VD...E.........W..........I........F........P......N........G.............N....T........IIVLSE..GRLLNLGNATG...........................................................................
Q49S42_DANRE/313-474             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCS.ALK.ALG.A...I...L.C.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............V...R...............Q........M.....D...M.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VILLAE..GRLLNLSCST-v..........................................................................
B4K1W7_DROGR/1-143               ..............................----------..---...-....-..-..-.-.-...M...FGG...K.....Q.....VV.VC.G.Y.G.D.............VGKGCAE.ALR.GQG.C...I...V.Y.....I..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....N......G.......F....R.....V.....V.............R.............L.......A............E.........V............I...R...............T........V.....D...V.....V.....V....S....A.....T....G....N....K...H....VV...TR.D.HM.N.R..MKN.GC..IL..C.N.....M...G..H...AI..SEI.D.....V..S.S.L.HTP....EM..........T.W.QH.V.R.S......Q......VD...H.........I..........I........W........P......D........G.............K....M........IILLAE..GRLVNLSCST-v..........................................................................
G8U1D0_9FIRM/184-346             ..............................NRYGTGQSTW..DGI...V....R..T..T.N.L...V...VAG...K.....T.....VV.VA.G.Y.G.W.............CGKGVAE.RAR.GLG.A...R...V.I.....V..T.....E...I..N.......P....V...R........A......N....E....A.........I...M....D......G.......H....Q.....V.....M.............T.............M.......H............Q.........A............A...P...............L........G.....D...Y.....F.....I....T....V.....T....G....N....T...H....VI...HA.D.HF.A.R..MKH.GA..IL..A.N.....A...G..H...FD..VEV.D.....V..R.G.L.RSL....AV..........D.T.VP.G.RtP......E......IT...G.........Y..........R........M........P......D........G.............R....I........LWLLAE..GRLVNLAAG--dg.........................................................................
SAHHA_XENLA/192-353              ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.Y.G.D.............VGKGCAQ.ALR.AFG.A...R...V.I.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......D............E.........A............S...K...............E........G.....N...I.....F.....V....T....T.....T....G....C....A...D....IV...EG.R.HF.E.N..MKD.DS..IV..C.N.....I...G..H...FD..IEL.D.....V..K.W.L.NEN....AV..........K.K.VN.I.K.P......Q......VD...R.........Y..........L........L........K......N........G.............R....H........IILLAE..GRLVNLGCAMG...........................................................................
D4X350_BACOV/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...IAG...K.....V.....VV.VC.G.Y.G.D.............VGKGCSH.SMR.SYG.A...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......E............E.........A............C...M...............E........G.....N...I.....F.....V....T....T.....T....G....N....I...D....II...RI.D.HM.E.K..MKD.QS..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.KHY...pGI..........K.C.VN.I.K.P......Q......VD...R.........Y..........Y........F........P......D........G.............H....S........IILLAD..GRLVNLGCATG...........................................................................
Q5CPH1_CRYPI/246-409             ..............................NTYGCRQSLL..HGL...F....N..G..C.I.Q...M...LAG...K.....K.....IV.VL.G.Y.G.E.............VGKGCAQ.GLS.GVG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......Y....Q.....V.....S.............V.............L.......E............D.........V............V...S...............E........A.....D...I.....F.....I....T....A.....T....G....N....K...D....VI...TV.E.HM.R.K..MKE.NA..YI..A.N.....I...G..H...FD..DEI.D.....V..Y.G.L.ENY...pGI..........K.V.IE.V.K.Q......N......VH...K.........F..........T........F........P......D.......tQ.............K....S........VILLCK..GRLVNLGCATG...........................................................................
D9UWZ3_9ACTO/240-402             ..............................NRYGIRHSLP..DGL...N....R..G..T.D.V...M...IGG...K.....F.....AV.VC.G.Y.G.D.............VGKGAVE.ALR.GQG.A...R...V.A.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......L....D.....V.....V.............E.............L.......D............D.........V............V...E...............R........A.....D...I.....F.....L....T....T.....T....G....N....F...G....IV...SA.E.QM.R.R..MKH.QA..IV..A.N.....V...G..H...FD..NEI.D.....M..A.G.L.AKV...pGI..........V.K.TE.V.K.P......Q......VH...T.........W..........R........F........P......D........G.............H....A........VIVLSE..GRLMNLGNATG...........................................................................
B4S716_PROA2/232-394             ..............................NLYGCRESLA..DGI...K....R..A..T.D.V...M...LAG...K.....I.....VV.VL.G.Y.G.D.............VGKGCAH.SMR.TYG.S...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........S...M....E......G.......F....E.....V.....T.............T.............M.......E............E.........A............V...K...............E........G.....N...I.....F.....V....T....T.....T....G....N....K...D....VI...TL.E.HM.K.Q..MRD.EA..II..C.N.....I...G..H...FD..NEI.Q.....V..D.M.L.NNF...eGA..........S.R.TN.I.K.P......Q......VD...K.........Y..........T........F........E......D........G.............R....S........IYLLAE..GRLVNLGCATG...........................................................................
H2PZL8_PANTR/289-450             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
A5PMG4_DANRE/313-474             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCS.ALK.ALG.A...I...V.C.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............V...R...............Q........M.....D...M.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VILLAE..GRLLNLSCST-v..........................................................................
SAHH_XYLF2/238-400               ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....L.....AV.VC.G.Y.G.D.............VGKGSAH.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....T.............T.............V.......E............D.........T............L...G...............Q........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.T.A..MKD.QV..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NAL...tGV..........Q.K.IN.I.K.P......Q......VD...K.........F..........I........L........P......N........G.............N....T........LFLLAE..GRLVNLGCATG...........................................................................
F8KZ72_PARAV/201-364             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....T.....VV.IA.G.Y.G.D.............VGKGCAK.SMA.AFG.A...R...V.V.....I..C.....E...V..D.......P....I...C........A......Y....Q....A.........A...M....E......G.......F....R.....V.....L.............T.............M.......E............E.........V............A...P...............A........G.....D...I.....F.....I....T....A.....T....G....C....C...N....VI...TG.Q.HM.E.Q..MKH.QA..II..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.ENN...pNI..........R.K.DE.I.K.P......Q......VS...R.........Y..........T........W........D......S.......tG.............K....S........LILLAE..GRLVNLGCATG...........................................................................
H0HCX1_RHIRD/227-386             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLQ.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............R.............L.......E............D.........V............V...S...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.RNL....--..........K.W.TN.I.K.P......Q......VD...M.........I..........E........F........P......K........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
SAHH_COXB2/199-358               ..............................NLYGCRESLI..DSI...K....R..A..T.D.V...M...IAG...K.....R.....VV.VC.G.Y.G.D.............VGKGCAQ.SLR.AYG.A...T...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............E.........M............A...D...............S........A.....D...I.....F.....V....T....A.....T....G....N....T...D....II...TH.E.HM.L.K..MKD.QA..IV..C.N.....I...G..H...FD..NEI.D.....I..A.S.L.QDY....--..........Q.W.MN.I.K.P......Q......VD...Q.........V..........I........F........P......D........G.............K....R........LTVLAQ..GRLVNLGCATG...........................................................................
Q3ZZN6_DEHSC/185-346             ..............................NRYGTGQSTL..DGI...T....R..A..T.N.F...L...WAS...K.....T.....VV.VV.G.Y.G.W.............CGHGVAM.RAK.GMG.A...H...I.I.....V..T.....E...V..D.......P....V...K........A......L....E....A.........V...M....D......G.......F....S.....V.....M.............P.............M.......A............E.........A............A...K...............L........G.....D...I.....F.....I....T....V.....T....G....D....K...H....VI...DK.D.HF.K.V..MKD.GA..TL..A.N.....S...G..H...FN..SEI.N.....I..P.A.L.ESL....SC..........G.K.DT.I.R.P......S......VE...E.........Y..........K........M........K......D........G.............R....R........IYLLGE..GRLINLAAAE-g..........................................................................
A3LHP0_PSEAI/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSSQ.SLR.QEG.M...I...V.K.....V..A.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....V.....V.............Spy........kngI.......N............DgteasidaaL............L...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DA.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgkdgfdA........H......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
F6T5I3_MONDO/322-483             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.ALG.A...I...V.Y.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....V.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...V.....V.....I....T....C.....T....G....N....K...N....VV...TR.E.HL.D.R..MKN.SC..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........VVLLAE..GRLLNLSCST-v..........................................................................
Q5CBQ5_THENE/174-335             ..............................NRYGTGQSTW..DAI...M....R..N..T.N.L...L...IAG...K.....R.....VV.VA.G.Y.G.W.............CGRGIAL.RAS.GLG.A...K...V.I.....V..T.....E...V..D.......P....V...R........A......V....E....A.........I...M....D......G.......F....E.....V.....M.............P.............M.......K............E.........A............V...K...............L........A.....D...F.....V.....V....T....A.....T....G....N....T...D....VL...TE.E.DI.L.S..LKD.GA..VL..A.N.....A...G..H...FN..VEI.P.....V..E.T.L.ERL....AV..........E.K.FE.A.R.P......N......VT...G.........Y..........V........L........K......N........G.............K....T........VFLLAE..GRLVNLAAG--dg.........................................................................
A2TQB7_9FLAO/197-358             ..............................NKYGCRESAV..DAI...R....R..A..T.D.T...M...LAG...K.....R.....VV.VC.G.Y.G.D.............VGKGTAA.SFK.GAG.S...I...V.T.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....K.............K.............L.......E............N.........V............V...G...............N........A.....D...I.....V.....I....T....T.....T....G....N....K...D....II...RG.E.HF.E.A..MRD.KV..IV..C.N.....I...G..H...FD..NEI.D.....M..A.W.L.NGN...hGA..........T.K.DE.I.K.P......Q......VD...K.........Y..........T........I........-......D........G.............K....D........IIVLAE..GRLVNLGCATG...........................................................................
Q6WN55_BRABE/194-354             ..............................NLYGCRESLV..DGI...K....R..A..T.D.I...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAQ.SLR.AFG.A...R...V.L.....I..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....Q.....V.....T.............T.............M.......D............E.........A............C...K...............L........G.....N...I.....F.....V....T....A.....T....G....C....A...D....II...TA.K.HF.Q.E..MKE.DA..IV..C.N.....I...G..H...FD..CEL.E.....V..K.W.L.NEN....-A..........K.K.DT.I.K.P......Q......VD...R.........Y..........T........L........P......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
D9Q6W2_CORP1/237-399             ..............................NKYGTRHSLI..DGI...N....R..A..T.D.M...L...MGG...K.....N.....VL.IC.G.Y.G.D.............VGKGCAE.AMA.GQG.A...R...V.K.....V..T.....E...A..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....P.....V.....V.............T.............V.......D............Q.........A............I...S...............E........A.....D...I.....V.....I....T....A.....T....G....N....M...G....II...SF.E.QM.L.K..MKD.HA..VL..G.N.....I...G..H...FD..NEI.D.....M..A.S.LlHRN....DV..........S.R.VT.I.K.P......Q......VD...E.........F..........T........L........P......N........G.............N....A........IIVLSE..GRLLNLGNATG...........................................................................
B6IV07_RHOCS/199-358             ..............................NLYGCRESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VA.G.F.G.D.............VGKGSAE.SLR.SQG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....Q......G.......Y....Q.....V.....V.............T.............M.......D............E.........A............A...P...............L........G.....D...I.....F.....V....T....A.....T....G....N....V...D....VI...TL.D.HM.R.A..MKD.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..A.A.L.QNY....--..........R.W.EE.V.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLAK..GRLVNLGCATG...........................................................................
H2WF06_CAEJA/196-357             ..............................NLYGIRESLP..DGI...K....R..A..T.D.V...M...LAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLK.AFG.S...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............L.......E............E.........A............A...P...............K........A.....N...I.....I.....V....T....T.....T....G....C....K...D....IV...TG.K.HF.E.L..LPN.DS..IV..C.N.....V...G..H...FD..CEI.D.....V..K.W.L.NVN....AA..........K.K.DT.I.K.P......Q......VD...R.........Y..........T........L........K......N........G.............R....N........IILLAE..GRLVNLGCATG...........................................................................
G7WLW0_METH6/184-345             ..............................NRYGTGQSTI..HGI...M....N..A..T.N.F...L...FAG...K.....T.....VV.VG.G.Y.G.W.............CGRGLAT.RAR.GMG.A...N...V.I.....V..V.....E...V..E.......P....R...K........A......L....E....A.........A...M....D......G.......F....R.....V.....M.............S.............M.......T............A.........A............A...P...............L........G.....D...L.....F.....V....T....V.....T....G....N....V...S....VI...RE.E.HV.E.L..MKD.QA..IV..A.N.....S...G..H...FN..VEI.D.....I..P.A.L.EEM....AS..........G.V.SE.V.Q.E......N......VL...E.........Y..........K........M........A......D........G.............R....R........IYLLAE..GRLINLAAAY-g..........................................................................
SAHH_SPHAL/233-392               ..............................NLYGCKESLV..DAI...R....R..G..T.D.V...M...LAG...K.....V.....AT.VA.G.F.G.D.............VGKGSAQ.SLR.NGG.A...R...V.L.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....V.............T.............M.......D............E.........A............V...K...............R........S.....D...I.....F.....V....T....A.....T....G....N....A...D....VI...TA.E.HM.A.A..MKN.MA..IV..C.N.....I...G..H...FD..SEI.Q.....I..A.A.L.ANY....--..........K.W.TE.V.K.P......Q......VD...L.........V..........E........F........P......D........G.............K....Q........IIILSK..GRLVNLGNATG...........................................................................
A6R164_AJECN/462-623             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAQ.ALH.SMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...V....S......G.......F....Q.....V.....T.............T.............M.......E............E.........A............A...P...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.E.HF.S.V..MKN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..S.W.L.KAN....AK..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........P......N........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
F8GKE5_NITSI/238-397             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....I.....AL.VC.G.Y.G.D.............VGKGCAQ.SLR.GLG.A...T...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............D.........A............C...D...............Q........A.....D...I.....F.....V....T....A.....T....G....N....L...R....VI...TH.D.HM.L.K..MKD.QA..IV..C.N.....I...G..H...FD..SEI.D.....I..A.S.I.QKY....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......T........G.............R....R........IIVLAQ..GRLVNLGCATG...........................................................................
C7NZX9_HALMD/190-351             ..............................NVHGTGESSL..ASI...A....M..T..T.N.L...S...WAG...K.....T.....VV.VA.G.Y.G.N.............CGKGVAK.KAS.GQN.A...D...V.I.....V..T.....E...V..E.......P....R...R........A......L....E....A.........H...M....E......G.......Y....D.....V.....M.............P.............M.......A............E.........A............A...A...............E........G.....D...V.....F.....I....T....T.....T....G....N....R...D....VI...VE.E.HF.E.A..MQD.GV..LL..A.N.....A...G..H...FD..VEV.D.....L..N.A.L.SAL....AV..........D.T.YE.A.R.D......G......VR...A.........Y..........E........M........A......D........G.............R....R........LNVLAE..GRLVNLAT---pia........................................................................
G4QA77_TAYAM/226-385             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....T.....AV.VV.G.F.G.D.............VGKGCAQ.ALA.ALR.A...Q...V.W.....V..C.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............I.......D............D.........V............A...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...QR.K.HL.E.A..MKN.EA..IV..C.N.....I...G..H...FD..NEI.D.....V..E.S.L.ADF....--..........Q.W.EE.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAK..GRLVNLGCATG...........................................................................
SAHH_ACIAD/204-379               ..............................NKYGCRHSLN..DAI...K....R..A..T.D.M...L...LSG...R.....R.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.R.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......Y....E.....V.....Vspykn...gvqtgK.............K.......Edi........nlD.........L............L...K...............N........T.....D...L.....I.....V....T....T.....T....G....N....Y...H....VC...DS.A.ML.D.T..LKA.GA..VV..C.N.....I...G..H...FD..TEI.D.....T..N.Y.L.RGY....--..........K.W.VE.V.K.P......Q......VH...Q.........V..........Y........R........S......En......eN.............D....Y........LILLSE..GRLVNLGNATG...........................................................................
D9PMP0_9ZZZZ/76-164              ..............................NVYGTGQSSL..DGI...I....R..A..T.S.V...L...LAG...K.....N.....FV.VA.G.Y.G.H.............CGKGCAM.RAA.GFG.A...S...V.I.....A..T.....E...I..K.......A....T...A........A......L....K....A.........T...L....D......G.......H....R.....V.....M.............T.............M.......D............E.........A............A...A...............V........G.....D...I.....F.....I....T....A.....T....G....M....K...-....--...--.-.--.-.-..---.--..--..-.-.....-...-..-...--..---.-.....-..-.-.-.---....--..........-.-.--.-.-.-......-......--...-.........-..........-........-........-......-........-.............-....-........------..-----------...........................................................................
B8GP48_THISH/231-390             ..............................NLYGCRESLV..DAI...K....R..A..T.D.V...M...IAG...K.....I.....AV.VC.G.Y.G.D.............VGKGSAQ.SLR.GLG.A...T...V.W.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............E.........A............A...G...............K........A.....D...I.....F.....V....T....A.....T....G....N....K...N....VI...TH.D.HM.A.A..MKN.QA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.L.RKH....--..........Q.W.EN.I.K.P......Q......VD...H.........V..........I........F........P......D........G.............K....R........IILLAE..GRLVNLGCGTG...........................................................................
H2Z7I7_CIOSA/288-449             ..............................NLYSCRESVL..DGL...K....R..T..T.D.I...M...FGG...K.....Q.....VV.IC.G.Y.G.E.............VGKGCCS.ALK.GLG.A...V...S.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......I....R.....V.....V.............R.............L.......H............E.........V............V...K...............T........A.....D...I.....F.....I....T....C.....S....G....N....K...N....VI...TR.E.SL.D.K..MKN.GA..IV..C.N.....M...G..H...SN..TEI.D.....V..T.S.L.KTN....DL..........T.W.EK.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
B0VFI4_CLOAI/226-388             ..............................NLYGCRESLA..DGI...K....R..G..T.D.I...M...VAG...K.....I.....VM.IC.G.Y.G.D.............VGKGCAQ.SMR.GLG.A...R...V.V.....I..S.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....N.............T.............V.......D............N.........M............V...E...............I........A.....D...I.....F.....I....T....A.....T....G....N....C...D....VI...RV.D.HI.L.K..MKN.NA..IL..C.N.....I...G..H...FD..NEI.Q.....V..N.K.L.YEM...eGV..........E.K.VN.I.K.P......Q......VD...L.........I..........K........L........P......N........D.............K....A........IILLSE..GRLVNLGNATG...........................................................................
A1KYB1_TOBAC/234-397             ..............................NLYGCRHSLP..DGL...M....R..A..T.D.V...M...IAG...K.....V.....AL.VA.G.Y.G.D.............VGKGCAA.ALK.QAG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........T...M....E......G.......L....Q.....V.....L.............T.............L.......E............D.........V............V...S...............D........V.....D...I.....F.....V....T....T.....T....G....N....K...D....II...MV.D.HM.R.K..MKN.NA..IV..C.N.....I...G..H...FD..NEI.D.....M..L.G.L.ETF...pGV..........K.R.IT.I.K.P......Q......TD...R.........W..........V........F........P......D.......tN.............S....G........IIVLAE..GRLMNLGCATG...........................................................................
F3GDG6_PSESJ/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidgendgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DS.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgpgsfdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
H3DMF5_TETNG/358-519             ..............................NLYCCRESIL..DGL...K....R..T..T.D.V...M...FGG...K.....Q.....VV.VC.G.Y.G.E.............VGKGCCA.ALK.AMG.S...I...V.Y.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........C...M....D......G.......F....R.....L.....V.............K.............L.......N............E.........V............I...R...............Q........V.....D...I.....V.....I....T....C.....T....G....N....K...N....VV...VR.E.NL.D.R..MKN.GC..IV..C.N.....M...G..H...SN..TEI.D.....V..A.S.L.RTP....EL..........T.W.ER.V.R.S......Q......VD...H.........V..........I........W........P......D........G.............K....R........IVLLAE..GRLLNLSCST-v..........................................................................
G3JMA0_CORMM/194-355             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VA.G.F.G.D.............VGKGCAM.ALH.GMG.A...R...V.I.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........A...M....A......G.......Y....Q.....V.....T.............T.............M.......E............K.........A............A...T...............I........G.....Q...I.....F.....V....T....T.....T....G....C....R...D....IL...TG.V.HF.E.A..MPN.DA..IV..C.N.....I...G..H...FD..IEI.D.....V..A.W.L.KKN....AS..........S.V.QN.I.K.P......Q......VD...R.........F..........L........M........P......S........G.............R....H........IILLAE..GRLVNLGCATG...........................................................................
H3KHF7_9BURK/227-386             ..............................NLYGCRESLV..DGI...K....R..A..T.D.V...M...IAG...K.....V.....AV.VV.G.Y.G.D.............VGKGCAQ.ALR.ALA.A...Q...V.W.....V..V.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............T.............M.......D............Y.........A............K...D...............K........A.....D...I.....F.....V....T....A.....T....G....N....Y...H....VI...TH.D.HM.V.A..MKN.EA..IV..C.N.....I...G..H...FD..SEI.D.....V..A.S.M.RKY....--..........R.W.DN.I.K.P......Q......VD...H.........I..........E........L........P......S........G.............N....R........ILLLAE..GRLVNLGCATG...........................................................................
F3S6I3_9PROT/192-351             ..............................NLYGCRESLV..DAI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VA.G.Y.G.D.............VGKGSAA.SLR.NAG.C...R...V.L.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............T.............M.......E............E.........A............A...P...............R........G.....D...I.....F.....V....T....A.....T....G....N....E...D....VI...TL.E.HM.R.E..MRH.RA..IV..C.N.....I...G..H...FD..SEI.Q.....I..N.A.L.RNF....--..........K.W.EN.I.K.P......Q......VD...E.........V..........V........F........P......D........G.............K....R........LIVLSE..GRLVNLGNATG...........................................................................
D7HUC8_PSESS/199-381             ..............................NKYGCRHSLN..DAI...K....R..G..T.D.H...L...LSG...K.....Q.....AL.VI.G.Y.G.D.............VGKGSAQ.SLR.QEG.M...I...V.K.....V..T.....E...V..D.......P....I...C........A......M....Q....A.........C...M....D......G.......F....E.....L.....V.............SpfidgendgteasI.......D............K.........A...........lL...G...............K........I.....D...L.....I.....V....T....T.....T....G....N....V...N....VC...DS.N.ML.K.A..LKK.RA..VV..C.N.....I...G..H...FD..NEI.D.....T..A.F.M.RKN....-W..........A.W.EE.V.K.P......Q......VH...K.........I..........HrtgpgsfdA........Q......N........D.............D....Y........LILLAE..GRLVNLGNATG...........................................................................
SAHH_XYLFM/238-400               ..............................NLYGCRESLA..DGL...K....R..A..M.D.V...M...LAG...K.....L.....AV.VC.G.Y.G.D.............VGKGSAH.SLR.AYG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......F....E.....V.....R.............T.............V.......E............D.........T............L...G...............Q........A.....D...I.....Y.....V....T....T.....T....G....N....K...D....VI...RI.E.HM.T.A..MKD.QV..IV..C.N.....I...G..H...FD..NEI.Q.....V..D.A.L.NTL...tGV..........Q.K.IN.I.K.P......Q......VD...K.........F..........I........L........P......N........G.............N....T........LFLLAE..GRLVNLGCATG...........................................................................
B4JLP1_DROGR/193-354             ..............................NLYGCRESLI..DGI...K....R..A..T.D.V...M...IAG...K.....V.....CC.VA.G.Y.G.D.............VGKGCAQ.ALK.GFG.G...R...V.I.....V..T.....E...V..D.......P....I...N........A......L....Q....A.........A...M....E......G.......Y....E.....V.....T.............T.............M.......E............E.........A............S...K...............E........A.....S...V.....Y.....V....T....T.....T....G....C....R...D....II...TS.T.HL.L.N..MPD.DA..IV..C.N.....I...G..H...FD..CEI.D.....V..D.W.L.NTN....AK..........S.K.VT.V.K.P......Q......VD...R.........Y..........T........M........P......N........G.............R....H........IILLAE..GRLVNLGCAHG...........................................................................
D7BVH1_STRBB/243-405             ..............................NKYGCRHSLV..DGI...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAE.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......Y....Q.....V.....A.............T.............L.......D............D.........V............V...E...............T........A.....D...I.....F.....I....T....T.....T....G....N....K...D....II...MA.S.DM.A.K..MKH.QA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.AAI...pGI..........V.K.DE.V.K.P......Q......VH...T.........W..........T........F........A......D........G.............K....A........IIVLSE..GRLLNLGNATG...........................................................................
H0QUL7_9ACTO/249-411             ..............................NKYGTRHSLI..DGI...N....R..G..T.D.V...L...IGG...K.....K.....VL.IC.G.Y.G.D.............VGKGCAE.SLA.GQG.A...R...V.Q.....V..T.....E...I..D.......P....I...N........A......L....Q....A.........L...M....D......G.......F....D.....V.....V.............T.............V.......E............D.........A............I...G...............N........A.....D...I.....V.....I....T....S.....T....G....N....L...G....II...TF.D.HM.K.Q..MKN.QA..IL..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.ETA...kGV..........T.R.IN.V.K.P......Q......VD...Q.........W..........V........F........E......D........G.............H....S........IIVLSE..GRLLNLGNATG...........................................................................
G4DT12_9GAMM/229-388             ..............................NLYGCRESLV..DAI...K....R..A..T.D.V...M...IAG...K.....L.....AL.VC.G.F.G.D.............VGKGSAA.SLR.GLG.A...T...V.W.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....R.....V.....V.............R.............I.......E............D.........V............V...S...............M........M.....D...I.....F.....V....T....T.....T....G....N....T...D....II...TH.D.HM.V.A..MKD.QA..IV..C.N.....I...G..H...FD..NEI.Q.....V..Y.S.L.KQY....--..........E.W.VN.I.K.P......Q......VD...Q.........I..........V........F........P......D........G.............H....R........ITLLAE..GRLVNLGCATG...........................................................................
C9RQQ0_FIBSS/235-397             ..............................NLYGCRHSLI..DGI...N....R..A..T.D.V...M...MAG...K.....I.....AV.VC.G.Y.G.D.............VGKGCAQ.SLR.GQG.A...R...V.I.....I..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....K.............T.............L.......D............E.........V............V...S...............Y........A.....D...I.....F.....V....T....T.....T....G....N....T...G....II...SA.A.QM.E.K..MKN.RA..IV..G.N.....I...G..H...FD..NEI.D.....M..A.G.L.KKI...pGI..........K.R.NE.I.K.P......Q......YD...E.........W..........I........F........A......D........G.............H....S........ILVLAE..GRLLNLGCATG...........................................................................
D1YY94_METPS/185-346             ..............................NRYGTGQSTL..HGI...I....N..A..T.N.I...L...LAG...K.....N.....VV.VV.G.Y.G.W.............CGRGVAM.RAK.GMG.S...N...V.I.....V..V.....E...V..S.......P....R...K........A......L....E....A.........A...M....D......G.......F....R.....V.....M.............D.............M.......K............Q.........A............A...K...............E........G.....D...L.....F.....I....T....V.....T....G....D....V...S....VI...RK.E.HF.K.L..MKD.QA..IV..C.N.....S...G..H...FN..VEI.D.....L..E.D.L.GKM....AK..........K.V.NE.V.K.T......D......VM...E.........Y..........V........L........D......D........G.............R....R........IYVLAE..GRLVNLACAF-g..........................................................................
F2G3J7_ALTMD/173-329             ...................mvglsawqtff----------..---...-....Q..T..T.H.L...T...LHE...K.....L.....VV.VI.G.Y.G.L.............VGQGVAA.SAK.AFG.A...Q...V.Q.....V..A.....E...L..D.......P....A...R........A......L....Q....A.........K...Y....D......G.......W....P.....V.....V.............G.............L.......D............E.........A............A...S...............Q........A.....D...V.....I.....A....T....A.....T....G....A....Y...G....VV...NS.K.HL.D.S..MKD.GA..FI..L.N.....V...G..H...VA..QEI.D.....V..P.Y.L.KNN....AS..........-.H.SE.P.M.P......Y......VN...A.........Y..........K........L........G......D........-.............K....T........LYLLAD..GSMFNLTAG--yg.........................................................................
G8SPH2_BRUCA/227-386             ..............................NKYGCKESLV..DGI...R....R..G..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAQ.SLA.GAG.A...R...V.K.....V..T.....E...V..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............T.............L.......D............D.........A............A...S...............T........A.....D...I.....V.....V....T....T.....T....G....N....K...D....VI...TI.D.HM.R.K..MKD.MC..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.A.L.RNL....--..........K.W.TN.V.K.P......Q......VD...L.........I..........E........F........P......D........G.............K....R........LILLSE..GRLLNLGNATG...........................................................................
B6BS13_9PROT/189-348             ..............................NLYGCRESLV..DGI...R....R..A..T.D.V...M...MSG...K.....I.....AI.VA.G.F.G.D.............VGKGSAA.SLR.QSG.A...R...V.L.....V..T.....E...A..D.......P....I...C........A......L....Q....A.........A...M....E......G.......Y....E.....V.....V.............L.............M.......E............E.........A............I...S...............R........A.....D...I.....V.....V....T....A.....T....G....N....K...D....IV...TA.D.HM.R.D..MKD.RA..IL..C.N.....I...G..H...FD..NEI.Q.....V..E.A.L.KNY....--..........K.W.TE.V.K.P......Q......VH...E.........I..........E........L........P......S........K.............K....R........IILLAE..GRLVNLGCATG...........................................................................
E3J3F3_FRASU/236-398             ..............................NKYGCRHSVI..DGL...N....R..A..T.D.V...L...IGG...K.....V.....AV.VC.G.Y.G.D.............VGKGCAD.ALR.GQG.A...R...V.I.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....Q.....V.....T.............T.............L.......E............D.........V............V...G...............I........A.....D...I.....F.....V....T....T.....T....G....N....F...N....II...TA.D.HM.G.A..MKH.QA..IV..S.N.....I...G..H...FD..NEI.D.....M..A.G.L.ARV...sGI..........E.K.IN.I.K.P......Q......VD...E.........W..........V........F........P......D........G.............H....S........ILVLAE..GRLMNLGCATG...........................................................................
F5J6U6_9RHIZ/227-386             ..............................NKYGCKESLV..DGI...R....R..A..T.D.V...M...MAG...K.....V.....AV.VC.G.Y.G.D.............VGKGSAA.SLQ.GAG.A...R...V.K.....V..T.....E...I..D.......P....I...C........A......L....Q....A.........A...M....D......G.......F....E.....V.....V.............R.............L.......E............D.........V............V...S...............S........A.....D...I.....F.....I....T....T.....T....G....N....K...D....VI...RI.E.HM.R.E..MKD.MA..IV..G.N.....I...G..H...FD..NEI.Q.....V..A.S.L.RNL....--..........K.W.TN.I.K.P......Q......VD...M.........I..........E........F........P......K........G.............N....R........IILLSE..GRLLNLGNATG...........................................................................
Q42939_NICSY/205-368             ..............................NLYGCRHSLP..DG