GenomeNet

Database: Pfam
Entry: Anthrax-tox_M
LinkDB: Anthrax-tox_M
Original site: Anthrax-tox_M 
#=GF ID   Anthrax-tox_M
#=GF AC   PF09156.5
#=GF DE   Anthrax toxin lethal factor, middle domain
#=GF AU   Sammut SJ
#=GF SE   pdb_1j7n
#=GF GA   83.00 83.00;
#=GF TC   108.40 108.30;
#=GF NC   82.90 82.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Anthrax_toxin
#=GF RN   [1]
#=GF RM   11700563
#=GF RT   Crystal structure of the anthrax lethal factor. 
#=GF RA   Pannifer AD, Wong TY, Schwarzenbacher R, Renatus M, Petosa C,
#=GF RA   Bienkowska J, Lacy DB, Collier RJ, Park S, Leppla SH, Hanna P,
#=GF RA   Liddington RC; 
#=GF RL   Nature. 2001;414:229-233.
#=GF DR   INTERPRO; IPR015239;
#=GF DR   SCOP; 1j7n; fa;
#=GF CC   Members of this family, which are predominantly found in anthrax
#=GF CC   toxin lethal factor, adopt a structure consisting of a core of
#=GF CC   antiparallel beta sheets and alpha helices. They form a long
#=GF CC   deep groove within the protein that anchors the 16-residue
#=GF CC   N-terminal tail of MAPKK-2 before cleavage. It has been noted
#=GF CC   that this domain resembles the ADP-ribosylating toxin from
#=GF CC   Bacillus cereus, but the active site has been modified to
#=GF CC   augment substrate recognition [1].
#=GF SQ   16
#=GS C3LLD9_BACAC/297-583  AC C3LLD9.1
#=GS I0DBP5_BACAN/297-583  AC I0DBP5.1
#=GS B0QQV5_BACAN/297-583  AC B0QQV5.1
#=GS LEF_BACAN/297-583     AC P15917.2
#=GS LEF_BACAN/297-583     DR PDB; 1PWV B; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWW A; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWQ B; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWP B; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1J7N A; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWP A; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1JKY A; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWU A; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWU B; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWV A; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWQ A; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 4DV8 A; 265-550;
#=GS LEF_BACAN/297-583     DR PDB; 1J7N B; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1PWW B; 264-550;
#=GS LEF_BACAN/297-583     DR PDB; 1YQY A; 265-550;
#=GS C3PE40_BACAA/297-583  AC C3PE40.1
#=GS B1UYJ6_BACAN/297-583  AC B1UYJ6.1
#=GS C2WFI3_BACCE/59-132   AC C2WFI3.1
#=GS B1GR52_BACAN/297-583  AC B1GR52.1
#=GS B0AYV3_BACAN/297-583  AC B0AYV3.1
#=GS Q52NH3_BACAN/297-583  AC Q52NH3.1
#=GS Q52NH3_BACAN/297-583  DR PDB; 1ZXV A; 264-550;
#=GS Q52NH3_BACAN/297-583  DR PDB; 1ZXV B; 264-550;
#=GS B0QAU0_BACAN/297-583  AC B0QAU0.1
#=GS D8HA97_BACAI/297-583  AC D8HA97.1
#=GS B3JDD9_BACAN/297-583  AC B3JDD9.1
#=GS C1EKB9_BACC3/297-583  AC C1EKB9.1
#=GS C2WFI4_BACCE/1-57     AC C2WFI4.1
#=GS B1F6V5_BACAN/297-583  AC B1F6V5.1
C3LLD9_BACAC/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
I0DBP5_BACAN/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSEEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
B0QQV5_BACAN/297-583             MLTRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
LEF_BACAN/297-583                MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
#=GR LEF_BACAN/297-583     SS    HHHHHHHHHHHHHHTHHHHHH--HHHHHHHHHHHS-B---HHHHHHTSTHHHHHHHHHS-GGGSSSS-HHHHHHHHHHHHHHHTSSSHHHHHHHHCCSTTTTSS-THHHHHHHHHHHHHTS-B-HHHHHHHHTT-TTSTSS-HHHHHHHHHHHHHHHHHS-CBSHBSSBSS-EEEEEEEGHHHHHHHHTTSB-SSSTTSB-HHHHHHHHTT-SEEEESS-EEEESS-----TTEEEEEEEE--TT-BEEEETTTEEEE-SSEEEEEEEEEEEEETTEEEEEEEEEEE...
C3PE40_BACAA/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
B1UYJ6_BACAN/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
C2WFI3_BACCE/59-132              MLSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEF---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------...
B1GR52_BACAN/297-583             MLTRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
B0AYV3_BACAN/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
Q52NH3_BACAN/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
#=GR Q52NH3_BACAN/297-583  SS    HHHHHHHHHHHHHHTHHHHHH--HHHHHHHHHCCS-B---HHHHHCTS-HHHHHHHHHS-STT-SS--HHHHHHHHHHHCCHTT-XXXXXXXXXXXXXX---SS--HHHHHHHHHHHHHTS-B-HHHHHHHHTT-TT-SSS-HHHHHHHHHHHHHHHHH---BS--TT-SS-EEEEEEETHHHHHHHHTTSB-SS-TTSB-HHHHHHHHTT--EEEE-S--EEESS-----TTEEEEEEEE--TT-BEEEETTTEEEE-SSEEEEEEEEEEEEETTEEEEEEEEEEE...
B0QAU0_BACAN/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
D8HA97_BACAI/297-583             MMARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEETELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNKIQVDSSNPLSEKEEEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTQAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
B3JDD9_BACAN/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
C1EKB9_BACC3/297-583             MMARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEETELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEEEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTQAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
C2WFI4_BACCE/1-57                --------------------------------------------------------------------------------------------------MDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKKG---------------------------------------------------------------------------------------------------------------------------------------ysk
B1F6V5_BACAN/297-583             MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
#=GC SS_cons                     HHHHHHHHHHHHHHTHHHHHH--HHHHHHHHHCCS-B---HHHHHCTSTHHHHHHHHHS-CCCSSSS-HHHHHHHHHHHCCHCTSSSHHHHHHHHCCSTTTTSS-THHHHHHHHHHHHHTS-B-HHHHHHHHTT-TTSTSS-HHHHHHHHHHHHHHHHHS-CBSHBTTBSS-EEEEEEECHHHHHHHHTTSB-SSSTTSB-HHHHHHHHTT-SEEEESS-EEEESS-----TTEEEEEEEE--TT-BEEEETTTEEEE-SSEEEEEEEEEEEEETTEEEEEEEEEEE...
#=GC seq_cons                    MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
//
DBGET integrated database retrieval system