GenomeNet

Database: Pfam
Entry: Anthrax-tox_M
LinkDB: Anthrax-tox_M
Original site: Anthrax-tox_M 
#=GF ID   Anthrax-tox_M
#=GF AC   PF09156.8
#=GF DE   Anthrax toxin lethal factor, middle domain
#=GF AU   Sammut SJ
#=GF SE   pdb_1j7n
#=GF GA   25.00 25.00;
#=GF TC   108.40 108.30;
#=GF NC   21.10 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Anthrax_toxin
#=GF RN   [1]
#=GF RM   11700563
#=GF RT   Crystal structure of the anthrax lethal factor. 
#=GF RA   Pannifer AD, Wong TY, Schwarzenbacher R, Renatus M, Petosa C,
#=GF RA   Bienkowska J, Lacy DB, Collier RJ, Park S, Leppla SH, Hanna P,
#=GF RA   Liddington RC; 
#=GF RL   Nature. 2001;414:229-233.
#=GF DR   INTERPRO; IPR015239;
#=GF DR   SCOP; 1j7n; fa;
#=GF CC   Members of this family, which are predominantly found in anthrax
#=GF CC   toxin lethal factor, adopt a structure consisting of a core of
#=GF CC   antiparallel beta sheets and alpha helices. They form a long
#=GF CC   deep groove within the protein that anchors the 16-residue
#=GF CC   N-terminal tail of MAPKK-2 before cleavage. It has been noted
#=GF CC   that this domain resembles the ADP-ribosylating toxin from
#=GF CC   Bacillus cereus, but the active site has been modified to
#=GF CC   augment substrate recognition [1].
#=GF SQ   3
#=GS LEF_BACAN/297-583    AC P15917.2
#=GS LEF_BACAN/297-583    DR PDB; 5D1T A; 267-550;
#=GS LEF_BACAN/297-583    DR PDB; 4XM7 A; 265-550;
#=GS LEF_BACAN/297-583    DR PDB; 4PKR A; 267-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWV B; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWW A; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1J7N A; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWP B; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWQ B; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWP A; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1JKY A; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 4PKQ A; 266-550;
#=GS LEF_BACAN/297-583    DR PDB; 4PKU A; 266-550;
#=GS LEF_BACAN/297-583    DR PDB; 4XM8 A; 266-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWU A; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWU B; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 4PKV A; 265-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWV A; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 4DV8 A; 265-550;
#=GS LEF_BACAN/297-583    DR PDB; 5D1S A; 265-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWQ A; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 1J7N B; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 4PKS A; 267-550;
#=GS LEF_BACAN/297-583    DR PDB; 4PKW A; 266-550;
#=GS LEF_BACAN/297-583    DR PDB; 4WF6 A; 266-550;
#=GS LEF_BACAN/297-583    DR PDB; 1PWW B; 264-550;
#=GS LEF_BACAN/297-583    DR PDB; 4PKT A; 265-550;
#=GS LEF_BACAN/297-583    DR PDB; 1YQY A; 265-550;
#=GS LEF_BACAN/297-583    DR PDB; 5D1U A; 267-550;
#=GS LEF_BACAN/297-583    DR PDB; 4XM6 A; 266-550;
#=GS C2WFI3_BACCE/59-132  AC C2WFI3.1
#=GS C2WFI4_BACCE/1-57    AC C2WFI4.1
LEF_BACAN/297-583               MLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV...
#=GR LEF_BACAN/297-583    SS    HHHHHHHHHHHHHHTHHHHHT--HHHHHHHHHHHS-B---HHHHHHTSTHHHHHHHHHS-GGGSSSS-HHHHHHHHHHHHHHHTTSSHHHHHHHHHCSTTTTSS-THHHHHHHHHHHHHTS-B-HHHHHHHHTT-TTSSSS-HHHHHHHHHHHHHHHHHS-CBSHTTTTTT-EEEEEEEGGGTHHHHHTTSB-SSSTTSB-HHHHHHHHHT-SEEEESS-EEEESS-----TTEEEEEEEE--TT-BEEEETTTEEEE-SSEEEEEEEEEEEEETTEEEEEEEEEEE...
C2WFI3_BACCE/59-132             MLSRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEF---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------...
C2WFI4_BACCE/1-57               --------------------------------------------------------------------------------------------------MDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKKG---------------------------------------------------------------------------------------------------------------------------------------ysk
#=GC SS_cons                    HHHHHHHHHHHHHHTHHHHHT--HHHHHHHHHHHS-B---HHHHHHTSTHHHHHHHHHS-GGGSSSS-HHHHHHHHHHHHHHHTTSSHHHHHHHHHCSTTTTSS-THHHHHHHHHHHHHTS-B-HHHHHHHHTT-TTSSSS-HHHHHHHHHHHHHHHHHS-CBSHTTTTTT-EEEEEEEGGGTHHHHHTTSB-SSSTTSB-HHHHHHHHHT-SEEEESS-EEEESS-----TTEEEEEEEE--TT-BEEEETTTEEEE-SSEEEEEEEEEEEEETTEEEEEEEEEEE...
#=GC seq_cons                   MLuRYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEF........................hDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYK+s..........................................................................................................................................
//
DBGET integrated database retrieval system