GenomeNet

Database: Pfam
Entry: Antimicrobial_6
LinkDB: Antimicrobial_6
Original site: Antimicrobial_6 
#=GF ID   Antimicrobial_6
#=GF AC   PF08036.9
#=GF DE   Diapausin family of antimicrobial peptide
#=GF AU   Lee SC
#=GF SE   Short protein clustering
#=GF GA   25.00 25.00;
#=GF TC   33.30 41.80;
#=GF NC   20.40 17.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   14706547
#=GF RT   Insect diapause-specific peptide from the leaf beetle has
#=GF RT   consensus with a putative iridovirus peptide. 
#=GF RA   Tanaka H, Sato K, Saito Y, Yamashita T, Agoh M, Okunishi J,
#=GF RA   Tachikawa E, Suzuki K; 
#=GF RL   Peptides 2003;24:1327-1333.
#=GF DR   INTERPRO; IPR012525;
#=GF CC   This family consists of diapausin-related antimicrobial
#=GF CC   peptides. Diapause during periods of environmental adversity is
#=GF CC   an essential part of the life cycle of many organisms with the
#=GF CC   molecular basis being different among animals. 
#=GF CC   Diapause-specific peptides provide anti-fungal activity and act
#=GF CC   as N-type voltage-gated calcium channel blocker [1].
#=GF SQ   5
#=GS H3DZ00_PRIPA/25-63  AC H3DZ00.1
#=GS H3EQ63_PRIPA/24-63  AC H3EQ63.1
#=GS H3DYZ9_PRIPA/25-63  AC H3DYZ9.1
#=GS H3EQ60_PRIPA/31-71  AC H3EQ60.1
#=GS H3FFE6_PRIPA/24-63  AC H3FFE6.1
H3DZ00_PRIPA/25-63             VEACDEVCRRTVPERNQCCRAHGY.QGMIRGMCT.GNSAYC
H3EQ63_PRIPA/24-63             VQQCDEVCPRIPRERDECCKANGHaGGMDGGLCF.FGLAFC
H3DYZ9_PRIPA/25-63             VEACNEVCGRSVEERNECCKAHGY.QGMIRGYCT.DGRAFC
H3EQ60_PRIPA/31-71             VEACDVTCTRIQRERDECCRAHGYrRGNMAGICAvRQIAFC
H3FFE6_PRIPA/24-63             VEACNEVCGRSHQERFECCRAHGFwRGMSRGACM.GGRAFC
#=GC seq_cons                  VEACDEVCsRoscERsECCRAHGYhpGMhRGhCs.sGpAFC
//
DBGET integrated database retrieval system