GenomeNet

Database: Pfam
Entry: Bacillus_PapR
LinkDB: Bacillus_PapR
Original site: Bacillus_PapR 
#=GF ID   Bacillus_PapR
#=GF AC   PF05968.9
#=GF DE   Bacillus PapR protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_4892 (release 9.0)
#=GF GA   21.10 21.10;
#=GF TC   32.80 36.30;
#=GF NC   19.50 18.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12198157
#=GF RT   A cell-cell signaling peptide activates the PlcR virulence
#=GF RT   regulon in bacteria of the Bacillus cereus group. 
#=GF RA   Slamti L, Lereclus D; 
#=GF RL   EMBO J 2002;21:4550-4559.
#=GF DR   INTERPRO; IPR009239;
#=GF CC   This family consists of the Bacillus species specific PapR
#=GF CC   protein. The papR gene belongs to the PlcR regulon and is
#=GF CC   located 70 bp downstream from plcR. It encodes a 48-amino-acid
#=GF CC   peptide. Disruption of the papR gene abolishes expression of the
#=GF CC   PlcR regulon, resulting in a large decrease in haemolysis and
#=GF CC   virulence in insect larvae. A processed form of PapR activates
#=GF CC   the PlcR regulon by allowing PlcR to bind to its DNA target.
#=GF CC   This activating mechanism is strain specific [1].
#=GF SQ   4
#=GS C2X4E2_BACCE/1-48  AC C2X4E2.1
#=GS Q9XCQ7_BACAN/1-48  AC Q9XCQ7.1
#=GS Q814S3_BACCR/1-48  AC Q814S3.1
#=GS A7GV97_BACCN/1-45  AC A7GV97.1
C2X4E2_BACCE/1-48             MKKLLIGSLLTLAMAWGISLGDIALEKSQIISHNDQEVQLAQEVPYEY.
Q9XCQ7_BACAN/1-48             MKKLLIGSLLTLAMAWGISLGDTALEKNQVISHNDQEVQLASDVPFEY.
Q814S3_BACCR/1-48             MKKLLIGSLLTLAMAWGISLGDTALEKSHIISHNDQEVQLAKDLPFEY.
A7GV97_BACCN/1-45             MKKFLACSLVAVAMLAGVAFG---VGQDQALTNQQEEVQLASDLPFE-h
#=GC seq_cons                 MKKLLIGSLLTLAMAWGISLGDhALEKsQlISHNDQEVQLApDlPFEY.
//
DBGET integrated database retrieval system